KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2022
Entry
SPUL_2022         CDS       T01740                                 

Gene name
lpxK
Definition
(GenBank) tetraacyldisaccharide 4'-kinase
  KO
K00912  tetraacyldisaccharide 4'-kinase [EC:2.7.1.130]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00540  Lipopolysaccharide biosynthesis
sel01100  Metabolic pathways
Module
sel_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SPUL_2022 (lpxK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sel01005]
    SPUL_2022 (lpxK)
Enzymes [BR:sel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.130  tetraacyldisaccharide 4'-kinase
     SPUL_2022 (lpxK)
Lipopolysaccharide biosynthesis proteins [BR:sel01005]
 Lipid A
  SPUL_2022 (lpxK)
SSDB
Motif
Pfam: LpxK Glyco_transf_4 AAA_26 MobB CbiA
Other DBs
NCBI-ProteinID: AET54348
Position
complement(2018922..2019899)
AA seq 325 aa
MIARIWSGESPLWRLLLPLSWLYGLVSGAIRLSYKLGFKRAWRAPVPVVVVGNLTAGGNG
KTPVVIWLVEKLQQRGVRVGVVSRGYGGKAAAYPLLLTPETTTAEAGDEPVLIYQRTGAP
VAVAPERAAAVKAILAAHNLQIIITDDGLQHYRLARDIEIVVIDGVRRFGNGWWLPAGPM
RERASRLKTVDAAIVNGGVARAGEIPMQLAPGLAVNLRTGARCDVAQLSNIVAMAGIGHP
PRFFATLEACGAHPQKCVPLADHQTLAPADVQALVGEGQTLVMTEKDAVKCRAFAEDNWW
FLPVDARLSGEQPDKLLEHITSLVR
NT seq 978 nt   +upstreamnt  +downstreamnt
atgattgcgcgtatctggtcgggtgaatccccgctatggcggttactactgccgctctcc
tggctgtatggcctggtgagcggggcgattcgtctgagctataagcttggttttaaacgc
gcctggcgagcgccggtaccggtggttgtggtagggaatcttacggctggcggtaacggt
aaaacccccgtagtcatttggctggtggaaaagctgcaacagcgtggcgtgcgcgtgggg
gtcgtttcccgcggctacggcgggaaagctgccgcttatccgctgctcctgacgcctgag
acgacaaccgcagaagcgggagatgaaccggtattgatttatcagcggaccggcgcgcct
gtcgcggtggcgcctgaacgcgccgcggcggtgaaagcgattctggcggcgcataatctg
cagattattatcaccgacgatgggttgcagcattaccgactcgcgcgagatattgaaatt
gtggtgattgacggggtgcgccgttttggcaacggctggtggcttcctgccggccctatg
cgcgaacgcgccagtcgcctgaaaaccgtggacgccgctatcgtcaatggcggcgtcgcc
cgggcaggcgaaatacccatgcagctagcgcctggactggcggtgaacttacgtacggga
gcgcgttgcgatgtagcgcagctgagcaatattgtggcgatggcgggcatcggtcatccg
ccgcgctttttcgccacgctggaagcctgtggcgcgcatccgcaaaagtgtgtcccgctg
gcggatcatcaaacgctcgcccctgctgacgttcaggcgttggtcggtgaaggacagacc
ctggtaatgacggaaaaagacgcggtgaaatgccgtgcttttgccgaagataactggtgg
ttcttaccggttgatgcgcgtttgtccggtgagcagcctgataagttgcttgaacatatc
acctcgctggttcgctag

DBGET integrated database retrieval system