KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2024
Entry
SPUL_2024         CDS       T01740                                 

Gene name
ycaI
Definition
(GenBank) putative competence-related protein
  KO
K02238  competence protein ComEC
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sel02044]
    SPUL_2024 (ycaI)
Secretion system [BR:sel02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   SPUL_2024 (ycaI)
SSDB
Motif
Pfam: Competence Lactamase_B DUF4131 Lactamase_B_2
Other DBs
NCBI-ProteinID: AET54350
Position
complement(2021681..2023894)
AA seq 737 aa
MILPVLPDTWILAVLFCLACLLCLIPHHYARYAALTLLFFMWGIFAARQAIWAGNVLPAA
TQEATVVITATDHMTTHYGRITHLHGKPLFPAVGIVLHGQYLPTEVCAGQQWAMTLKVRA
VHGQLNEGGFDSQRYALAQHQPLTGRFLQAKAINPECSLRGRYLASLRATLAPYPWQQVI
LALGMGERGAVSQEVKAVMRDTGTAHLMAISGLHIAFAALLAAGLIRGGQFFLPVRWIRW
QTPLLGGILCAICYAWLTGLQPPALRTVAALSVWGGLKLSGRQWSGWQVWCCCLAAIIFA
DPVAVISQSLWLSAFAVAGLLFWYQWFPAPNGNFPRGLRWLLNLLHLQAGITLLLLPLQV
ALFHGISVTAMLANLFAVPWVTFVTVPLILAGMILHLTGPFFLEEWVWYLTDRALAALFY
LLNALPQGWVNIDNRWQWLTLLPWLTLIAWRLNVWHTCPAVCLCGLLLMSWPLWRPINAS
GWQVHMLDVGQGLAIAIVRGDKVILYDTGRAWPEGDSGQQVIIPWLRWHNLTPEGVILSH
EHLDHRGGLRSLQQVWPSMWIRSPLGWQGHLPCFRGEQWQWQGLTFQAHWPLRESADRGN
NRSCVVKVDDGVHSILLTGDIEAGAEQKMLSRYWRHLAATFIQVPHHGSNTSSSLPFIQR
VHGEAALASASRYNAWRLPSRKVKQRYRQQAYQWFDTPHQGQISLLFSPQGWRIQGLRDQ
ILPRWYHQWFGVSEDNG
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgatattgccagtattacctgatacgtggattctcgcggtgctgttttgtctggcatgt
ttgctttgcctcataccccatcactatgcgcgctacgcggcattaaccttgctctttttc
atgtgggggatatttgccgccaggcaggccatctgggcgggaaacgtcctgcccgctgcg
acgcaggaggcgacagtcgtcattactgccaccgatcatatgaccactcattatgggcga
attacccatttgcatggaaagccactctttcctgctgtagggattgtcctgcatggccag
tacttacccacggaagtgtgtgccggacagcagtgggcgatgacgctgaaggtcagagcg
gtacacggacagcttaacgaaggcggttttgatagccagcgttacgcgctggcgcagcac
caaccgttgaccgggcgttttctacaggctaaagcgattaaccctgagtgtagcttgcgt
gggcgctatcttgcttcgcttcgcgctacgcttgcgccttatccgtggcagcaggttatt
ctggcgttgggaatgggggagcggggagcggtgtcgcaggaggtgaaggccgttatgcgc
gatacggggactgcccatttgatggcgatttccggcctgcatatcgcttttgctgcgtta
ttggctgccggattaatccgtggcggacaattctttttgccggtcagatggattcgttgg
cagacgccattgctgggcggcattctttgcgcgatatgttatgcctggcttaccggctta
caaccgcctgcgctgcgcacggtggcggcgctgagcgtctggggaggattaaaattaagc
ggacgacagtggagcggctggcaagtctggtgctgctgtctggccgcgattattttcgcc
gatcctgtggcggttatatcacaaagtctttggctgtcagcatttgcggttgccggcctg
ttattctggtatcagtggtttcctgcgccaaacggaaattttccacggggcttacgttgg
ttgcttaacctgcttcacctacaggcaggcattacacttctgcttttgcctctccaggtg
gcgctttttcatggcataagcgttaccgcaatgctggcgaatctttttgccgtaccctgg
gtcacatttgtgacggttccgctcatcctggcgggaatgattctgcatttaaccgggccg
ttttttcttgaagagtgggtatggtacctgaccgatcgcgcgttagccgcgctattttac
ctgttgaatgctttaccgcagggctgggtcaatattgataaccgttggcagtggctgacg
cttttaccctggctaacgcttatcgcgtggcgattaaacgtctggcatacctgtccggcg
gtctgtttatgcgggttattgttgatgagctggccactctggcggccgataaacgccagc
ggatggcaggtgcatatgctggatgtcggtcaggggctggcgatagcgatcgtcaggggc
gataaagtaatactctacgataccggtcgggcatggccggagggcgacagcgggcaacag
gttattattccttggttgcgctggcataatctgacgccggagggcgttattttgagtcat
gagcatctggatcatcggggcgggctgcgttcgctacagcaggtctggccgtcaatgtgg
attcgcagcccgttaggctggcagggacatttgccctgttttcgcggtgagcagtggcaa
tggcaggggctaacgtttcaggcgcactggccgttacgcgaaagtgccgatcgaggaaat
aaccgctcctgtgtggtcaaagtggatgacggcgtacatagcatcctgctcacgggcgat
attgaagcgggcgctgaacaaaaaatgctaagtcgttactggcgacatcttgcggcgacg
tttatccaggtgccgcatcatggtagtaatacgtcgtcgtcgctaccatttattcagcgc
gtacatggtgaagcggcgctggcgtccgcatcgcgctataacgcatggcggctgccgtcc
cgcaaggtaaaacagcgctaccgacagcaggcgtatcagtggtttgatacaccccaccag
gggcaaatttcgctgctgttttctccgcagggctggcgcatacaaggcttacgggatcaa
attttacctcgctggtatcatcagtggtttggcgtgtccgaggataacgggtag

DBGET integrated database retrieval system