KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2025
Entry
SPUL_2025         CDS       T01740                                 

Gene name
himD
Definition
(GenBank) integration host factor beta-subunit (IHF-beta)
  KO
K05788  integration host factor subunit beta
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sel03032]
    SPUL_2025 (himD)
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_2025 (himD)
   03400 DNA repair and recombination proteins [BR:sel03400]
    SPUL_2025 (himD)
DNA replication proteins [BR:sel03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SPUL_2025 (himD)
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Nucleoid associated proteins
   IHF (integration host factor)
    SPUL_2025 (himD)
DNA repair and recombination proteins [BR:sel03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      SPUL_2025 (himD)
SSDB
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg HU-CCDC81_euk_2 MDMPI_C Ribosomal_L27_C
Other DBs
NCBI-ProteinID: AET54351
Position
complement(2024176..2024460)
AA seq 94 aa
MTKSELIERLATQQSHIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaccaagtcagaattgattgaaagacttgcaacccagcaatctcacattcccgctaag
gcggttgaagacgcggtaaaagagatgctggagcatatggcctcgactcttgcgcagggc
gagcgtattgaaatccgcggtttcggcagtttttctttgcattaccgcgcgcctcgtacc
ggacgtaaccccaagaccggcgataaagtggaactggaaggaaaatacgttcctcacttt
aaaccgggtaaagaactgcgcgatcgcgccaatatttacggttaa

DBGET integrated database retrieval system