KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2026
Entry
SPUL_2026         CDS       T01740                                 

Gene name
rpsA
Definition
(GenBank) 30S ribosomal protein S1
  KO
K02945  small subunit ribosomal protein S1
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPUL_2026 (rpsA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sel03011]
    SPUL_2026 (rpsA)
Ribosome [BR:sel03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    SPUL_2026 (rpsA)
SSDB
Motif
Pfam: S1 PCB_OB DUF2097
Other DBs
NCBI-ProteinID: AET54352
Position
complement(2024616..2026289)
AA seq 557 aa
MTESFAQLFEESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGEL
EIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEKAYEDAETVTGVINGKVKGGF
TVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENSA
ERDQLLENLQEGMEVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDE
INVKVLKFDRERTRVSLGLKQLGEDPWVAIAKRYPEGTKLTGRVTNLTDYGCFVEIEEGV
EGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLKQCKSNPWQQFAET
HNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNEPGEEAVREYKKGDEIAAVVL
QVDAERERISLGVKQLAEDPFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRA
SEASRDRVEDATLVLSVGDDVEAKFTGVDRKNRAISLSVRAKDEADEKDAIATVNKQEDA
NFSNNAMAEAFKAAKGE
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgactgaatcttttgctcaactctttgaagaatccttaaaagaaatcgaaacccgcccg
ggttccatcgttcgtggtgttgttgttgctatcgacaaagacgtagtactggttgacgcc
ggtctgaaatctgagtctgccattccggctgagcagttcaaaaacgcccagggcgaactg
gaaatccaggttggtgacgaagttgacgttgctctggatgcagtagaagacggcttcggt
gaaactctgctctctcgtgagaaagctaaacgtcacgaagcatggatcacgctggaaaaa
gcttacgaagatgctgaaactgttaccggtgttatcaacggcaaagttaagggtggcttc
actgttgagctgaacggtattcgcgcgttcctgccaggttctctggtagacgttcgtccg
gtgcgtgacactctgcacctggaaggcaaagagcttgaattcaaagtaatcaagctggac
cagaaacgtaacaacgttgtggtttctcgtcgtgccgttatcgaatccgaaaacagcgca
gaacgcgatcagctgctggaaaacctgcaggaaggcatggaagttaaaggtatcgttaag
aacctcactgactacggtgcattcgttgatctgggcggcgttgacggcctgctgcacatc
actgatatggcctggaaacgcgttaagcatccgagcgaaatcgtgaacgttggcgacgaa
atcaacgtgaaagtgctgaaattcgaccgcgagcgtacccgtgtatccctgggcctgaaa
cagctgggcgaagatccgtgggttgctatcgctaaacgttatccggaaggtaccaaactg
accggtcgcgtgaccaacctgaccgactacggctgcttcgttgaaatcgaagaaggcgtt
gaaggcctggttcacgtttccgaaatggactggaccaacaaaaacatccacccgtccaaa
gtggttaacgttggcgacgtagtggaagtgatggttctggatatcgacgaagaacgtcgt
cgtatctccctgggtctgaagcagtgcaaatctaacccgtggcagcagttcgcagaaacc
cacaacaagggcgaccgcgttgaaggtaaaatcaagtctatcactgacttcggtatcttc
atcggcctggacggcggcatcgacggcctggttcacctgtctgacatctcctggaacgaa
ccaggcgaagaagcagttcgtgaatacaaaaaaggcgacgaaatcgctgcagttgttctg
caggttgacgcagaacgtgaacgtatctccctgggcgttaaacagctcgcagaagatccg
ttcaacaactgggttgctctgaacaagaaaggcgctatcgtaaccggtaaagtcactgca
gttgacgcgaaaggcgcaaccgtagaactggctgacggcgttgaaggttacctgcgtgct
tctgaagcatcccgtgaccgcgttgaagatgcgactctggttctgagcgttggcgacgac
gttgaagctaaattcaccggcgttgatcgtaaaaaccgcgcaatcagcctgtctgttcgt
gcgaaagacgaagctgacgagaaagatgccatcgcaactgttaacaaacaggaagatgca
aacttctctaacaacgcaatggctgaagcattcaaagcagctaaaggcgagtaa

DBGET integrated database retrieval system