KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2027
Entry
SPUL_2027         CDS       T01740                                 

Gene name
cmk
Definition
(GenBank) cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00240  Pyrimidine metabolism
sel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPUL_2027 (cmk)
Enzymes [BR:sel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     SPUL_2027 (cmk)
SSDB
Motif
Pfam: Cytidylate_kin Cytidylate_kin2 AAA_18 AAA_17 ABC_tran AAA_33 SKI AAA_22 ADK dNK TsaE ATP_bind_2 AAA RNA_helicase
Other DBs
NCBI-ProteinID: AET54353
Position
complement(2026403..2027086)
AA seq 227 aa
MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDLASEDAL
VPLASHLDVRFVSTDGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAF
REAPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQANGFSVNFERLLAEIKE
RDDRDRNRAVAPLVPAADALVLDSTRLSIEQVIEKALQYARQKLALA
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacggcaattgccccggtaataaccattgatggcccaagcggtgcaggtaaaggcacc
ttgtgcaaagcaatggcggaagcattgcaatggcatctgctggattccggcgcgatatac
cgcgtactggcgctggcggcattgcatcaccatgtcgatctcgcctctgaagatgcgctg
gtgccgctggcgtcccatctggacgtgcgtttcgtctcaacggacggcaacctggaagtt
atcctggaaggcgaggacgttagcggcgaaatccgtacgcaggaagtcgcgaacgcggca
tcccaggtggcagcattcccacgcgtgcgtgaagcgcttcttcgccgccaacgcgcattc
cgcgaagcgcctggtttaatcgccgatggacgcgatatggggaccgtggtcttcccggat
gcgccggtaaaaattttccttgacgcctcctcggaggaacgtgcgcatcgacgtatgcta
cagttgcaggcgaatggctttagtgttaactttgaacgccttttggccgagatcaaggag
cgcgacgatcgcgatcgtaatcgcgctgtagcgccgttagttcctgctgctgatgcatta
gttttggattctacccgattaagcattgagcaagtgattgaaaaagcgttacaatatgcg
cgccaaaaattggctctcgcttaa

DBGET integrated database retrieval system