KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2028
Entry
SPUL_2028         CDS       T01740                                 

Gene name
ycaL
Definition
(GenBank) putative lipoprotein
  KO
K07387  metalloprotease [EC:3.4.24.-]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sel01002]
    SPUL_2028 (ycaL)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     SPUL_2028 (ycaL)
Peptidases and inhibitors [BR:sel01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   SPUL_2028 (ycaL)
SSDB
Motif
Pfam: Peptidase_M48
Other DBs
NCBI-ProteinID: AET54354
Position
complement(2027259..2028020)
AA seq 253 aa
MKNKSLLLAVAISATLLAGCKNGVNGNLIASSGMSAYKAATLSDADVKALSNNACKQMDS
ENQLAGSKSKYTKRLSKIAKALGNNIDGTPVSYKVYMTSDINAWAMANGCVRVYSGLMDL
MTDNEIEGVLGHELGHVSLGHSRKAMQTAYATLAARDAISATSGVAAQLSQSQLGDLAEG
VINSAFSRSQESDADDFSYDLLKKRGINTQGLVTAFDKFATMDAGHAKSLMDSHPASADR
AQHMRDRIAEDKK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaaaaataaatcattactactggcggtggcgatttccgccacgctactggcaggatgt
aaaaatggcgtgaatggcaatttaatcgccagttcaggcatgtcagcctacaaagccgcc
acactgtccgatgcggatgttaaggcattatctaataatgcctgtaaacaaatggacagc
gagaatcaactggcaggttcgaaaagcaaatacaccaaacgtctgagcaaaatcgccaaa
gcgctgggtaacaacattgacggtacgccggttagctataaagtctatatgaccagcgat
atcaacgcatgggcgatggcgaacggttgcgttcgcgtatactccggcctgatggatctg
atgaccgataatgaaattgaaggcgtactgggccatgaactgggccatgtctctttaggg
cactctcgcaaggcaatgcagaccgcttatgccacgctggcggctcgcgatgcgatttcc
gccaccagcggcgtcgcagcgcagctttcccagtctcaattgggcgatctggcggaaggc
gtcatcaattcggcgttttctcgcagtcaggagtcggatgcggatgacttctcttacgat
ctgctgaaaaaacgcgggattaacacccagggcttagtcacggcattcgataaattcgcc
acaatggacgcaggtcatgcaaaatcattgatggactcccacccggcttcagccgatcgc
gcgcagcatatgcgcgacagaattgccgaagataaaaagtaa

DBGET integrated database retrieval system