KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2029
Entry
SPUL_2029         CDS       T01740                                 

Gene name
aroA
Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01230  Biosynthesis of amino acids
Module
sel_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPUL_2029 (aroA)
Enzymes [BR:sel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     SPUL_2029 (aroA)
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: AET54355
Position
complement(2028163..2029446)
AA seq 427 aa
MESLTLQPIARVDGAINLPGSKSVSNRALLLAALACGKTVLTNLLDSDDVRHMLNALSAL
GINYTLSADRTRCDITGNGGPLRAPGALELFLGNAGTAMRPLAAALCLGQNEIVLTGEPR
MKERPIGHLVDSLRQGGANIDYLEQENYPPLRLRGGFIGGDIEVDGSVSSQFLTALLMTA
PLAPKDTIIRVKGGLVSKPYIDITLNLMKTFGVEIANHHYQQFVVKGGQQYHSPGRYLVE
GDASSASYFLAAGAIKGGTVKVTGIGRKSMQGDIRFADVLEKMGATITWGDDFIACTRGE
LHAIDMDMNHIPDAAMTIATTALFAKGTTTLRNIYNWRVKETDRLLAMATELRKVGAEVE
EGHDYIRITPPAKLQHADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARMSTPA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaatccctgacgttacaacccatcgcgcgggtcgatggcgccattaatttacctggc
tccaaaagtgtttcaaaccgtgctttgctcctggcggctttagcttgtggtaaaaccgtt
ctgacgaatctgctggatagcgatgacgtccgccatatgctcaatgccctgagcgcgttg
gggatcaattacaccctttctgccgatcgcacccgctgtgatatcacgggtaatggcggc
ccattacgtgcgccaggcgctctggaactgtttctcggtaatgccggaaccgcgatgcgt
ccgttagcggcagcgctatgtctggggcaaaatgagatagtgttaaccggcgaaccgcgt
atgaaagagcgtccgataggccatctggttgattcgctgcgtcagggcggggcgaatatt
gattacctggagcaggaaaattatccgcccctgcgtctgcgcggcggttttatcggcggc
gacattgaggttgatggtagcgtttccagccagttcctgaccgctctgctgatgacggcg
ccgctggcccctaaagacacaattattcgcgttaaaggcggactggtatcaaaaccttac
atcgatatcacgctaaatttaatgaaaacctttggcgtggagatagcgaaccaccactac
caacaatttgtcgtgaagggaggtcaacagtatcactctccaggtcgctatctggtcgag
ggcgatgcctcgtcagcgtcctattttctcgccgccggggcgataaaaggcggcacggta
aaagtgaccggaattggccgcaaaagtatgcagggcgatattcgttttgccgatgtgctg
gagaaaatgggcgcgaccattacctggggcgatgattttattgcctgcacgcgcggtgaa
ttgcacgccatagatatggatatgaaccatattccggatgcggcgatgacgattgccacc
acggcgctgtttgcgaaaggaaccacgacgttgcgcaatatttataactggcgagtgaaa
gaaaccgatcgcctgctcgcgatggcgaccgagctacgtaaagtgggcgctgaagttgaa
gaagggcacgactatattcgtatcacgccgccggcgaagctccaacacgcggatattggc
acgtacaacgaccaccgtatggcgatgtgcttctcactggtcgcactgtccgatacgcca
gttacgatcctggaccctaaatgtaccgcaaaaacgttccctgattatttcgaacaactg
gcgcgaatgagtacgcctgcctaa

DBGET integrated database retrieval system