KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2030
Entry
SPUL_2030         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54356
Position
2029445..2029558
AA seq 37 aa
MKLNSQKTEIKTPQTGRGDEKRNELAVATLKIDHEIG
NT seq 114 nt   +upstreamnt  +downstreamnt
atgaaactcaactctcaaaaaacagaaataaaaaccccacagactggccgtggggatgaa
aaaagaaacgaattagccgtggcgacgctcaaaatcgatcatgaaatcggttag

DBGET integrated database retrieval system