KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2031
Entry
SPUL_2031         CDS       T01740                                 

Gene name
serC
Definition
(GenBank) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00260  Glycine, serine and threonine metabolism
sel00270  Cysteine and methionine metabolism
sel00680  Methane metabolism
sel00750  Vitamin B6 metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01120  Microbial metabolism in diverse environments
sel01200  Carbon metabolism
sel01230  Biosynthesis of amino acids
Module
sel_M00020  Serine biosynthesis, glycerate-3P => serine
sel_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SPUL_2031 (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPUL_2031 (serC)
   00270 Cysteine and methionine metabolism
    SPUL_2031 (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPUL_2031 (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sel01007]
    SPUL_2031 (serC)
Enzymes [BR:sel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     SPUL_2031 (serC)
Amino acid related enzymes [BR:sel01007]
 Aminotransferase (transaminase)
  Class V
   SPUL_2031 (serC)
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-ProteinID: AET54357
Structure
PDB: 
3QM2

Position
complement(2029517..2030605)
AA seq 362 aa
MAQVFNFSSGPAMLPAEVLKLAQQELRDWHGLGTSVMEISHRGKEFIQVAEEAEQDFRDL
LNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKTTADYVDAGYWAASAIKEAKKYCAPQIID
AKITVDGKRAVKPMREWQLSDNAAYLHYCPNETIDGIAIDETPDFGPEVVVTADFSSTIL
SAPLDVSRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHESCPSILDYTVLNDNDSMFNT
PPTFAWYLSGLVFKWLKAQGGVAAMHKINQQKAELLYGVIDNSDFYRNDVAQANRSRMNV
PFQLADNALDKVFLEESFAAGLHALKGHRVVGGMRASIYNAMPIEGVKALTDFMIDFERR
HG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggctcaggtctttaattttagttcaggtccggcgatgctaccggcggaagtacttaaa
ctggcgcaacaggaactgcgtgactggcacggtcttggtacgtcggtaatggaaattagc
catcgaggcaaagagtttatccaggtcgctgaagaggcggagcaggattttcgcgatctc
cttaatatcccctccaactataaagttttattttgtcacggcggcggtcgcgggcagttt
gctggcgtgccgctcaatctgctgggcgataaaaccacggcggattatgtcgatgctggt
tactgggcggcgagcgccatcaaagaagccaaaaaatactgtgcgccgcagattatcgac
gccaaaatcaccgttgacggcaaacgtgccgtaaaaccgatgcgcgagtggcagctttcc
gataacgccgcttatttacactattgcccgaatgagaccattgacggcatcgccatcgat
gaaacgccggattttggcccggaagtggtcgtcacggcggatttttcttctaccatcctg
tctgcgccgctggacgtctctcgctatggcgtaatttatgctggcgcgcagaagaatatc
ggtccggcaggactgacgctggttatcgtccgggaggatctgttaggcaaggcgcatgag
agctgcccgtccatcctcgactacaccgtcctgaatgataacgactcgatgtttaatacg
ccgccgactttcgcctggtatctttccggtctggtgttcaaatggttgaaagcgcagggc
ggcgtggcggcgatgcacaaaatcaatcagcaaaaagcggagttgctgtacggtgtgatt
gataacagcgatttctaccgtaacgatgtcgcacaggccaaccgttcgcggatgaatgtt
ccgttccagttagcggacaatgcgctggacaaggtctttctggaagagtctttcgccgcc
ggtctgcacgccttaaaagggcaccgtgttgttggcgggatgcgcgcctctatctataac
gccatgccgattgaaggggtaaaagcgctaaccgatttcatgatcgattttgagcgtcgc
cacggctaa

DBGET integrated database retrieval system