KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2032
Entry
SPUL_2032         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: DUF421 NCD3G TF_Zn_Ribbon NOB1_Zn_bind DZR_2
Other DBs
NCBI-ProteinID: AET54358
Position
complement(2030791..2031483)
AA seq 230 aa
MKAFDLQRMALDNVPVAFLGEVALRSFYTFVLVFLFLKVTGRRGVRQMSLFEVLIILTLG
SAAGDVAFYDDVPMLPVLVVFITLALLYRLVMWLMAHSEKLEDLLEGKSVVIVEDGELAW
EKLQRSNMTEFEFFMELRLNGVEQLGQVRLAILETNGQISVYFFENKDVKPGLSILPEHC
TPRFIVAPEAGDYACVRCSEVIRMNIGEKQLCPRCANPEWTKASRAKRVV
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaaagcatttgatttgcaacgaatggcgctggataacgtgccggtagcgtttttgggg
gaagtggcgctgcgtagcttttacacctttgttctggtgtttcttttcttaaaggtgaca
ggacgacgcggcgtacggcaaatgtcgctttttgaagtgctgatcattttgacattggga
tcggcggcaggcgacgtcgcgttttatgatgacgttccgatgctccctgttctggtggta
ttcatcaccctggcgctgctctatcgcctggtcatgtggctgatggcgcatagtgaaaag
ttggaagatctgctggaaggcaagtcggtggtcattgttgaagacggcgaactggcgtgg
gaaaaactgcagcgctcgaacatgacggagtttgagttttttatggagcttcgcttgaat
ggcgttgagcaactggggcaggtcagactggccatcctggagacaaacggacaaatcagc
gtctatttctttgaaaataaagacgttaagccggggttaagcattcttcctgagcactgt
acgccacgctttatcgtggcgccggaggctggcgactatgcctgcgtacgttgcagtgaa
gtgatacgcatgaatatcggggaaaagcaattatgtccgcgctgcgcaaatccagaatgg
acgaaggcaagccgggctaaacgcgttgtttaa

DBGET integrated database retrieval system