KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2034
Entry
SPUL_2034         CDS       T01740                                 

Gene name
focA
Definition
(GenBank) putative formate transporter (formate channel)
  KO
K06212  formate transporter
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_2034 (focA)
Transporters [BR:sel02000]
 Other transporters
  Pores ion channels [TC:1]
   SPUL_2034 (focA)
SSDB
Motif
Pfam: Form_Nir_trans
Other DBs
NCBI-ProteinID: AET54360
Structure
PDB: 
3Q7K

Position
2033827..2034642
AA seq 271 aa
MAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITVTTGTGAMPYGMAKLIGGIC
FSLGLILCVICGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLIGALLFVLLMWL
SGEYMTANGQWGLNVLQTADHKMHHTFIEAVCLGILANLMVCLAVWMSYSGRSLMDKAFI
MVLPVAMFVASGFEHSIANMFMIPMGIVIRDFATPEFWTAVGSSPESFSHLTVMSFITDN
LIPVTIGNIIGGGLLVGLTYWVIYLRGNEHH
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccaaagtggctgaagaagcaggcgtctataaagcaacgaaacatccgcttaagact
ttctatctggcgattaccgccggcgtattcatttcaattgcctttgttttttatattact
gtgacaaccggtactggcgcgatgccttatggcatggcgaaacttatcgggggtatctgt
ttctctttgggactgattctctgtgttatttgcggcgctgatctcttcacctctactgtt
ctgatcgttgtagctaaagctagcggtcgcatcacctgggggcaactggctaaaaactgg
ttaaacgtctattttggtaacctgattggcgctctgcttttcgtgttactgatgtggctt
tccggcgagtatatgactgccaacggtcaatggggacttaacgtcctgcaaaccgccgac
cacaaaatgcaccacacttttattgaagctgtctgcctcggtattctggcgaacctgatg
gtttgtctggccgtgtggatgagctactcaggtcgtagcctgatggacaaagcgttcatc
atggtactgcccgtcgccatgtttgtcgccagcggttttgagcacagtatcgcaaacatg
tttatgattcctatgggtattgtaatacgcgattttgctacaccggagttttggaccgcg
gttggttcgtctccggaaagtttttctcacctgaccgtgatgagcttcatcactgataac
ctgattccggtcacgatcggtaatattatcggcggcggtttgttggtcgggttgacatac
tgggtcatttacctgcgtggtaacgagcatcattaa

DBGET integrated database retrieval system