KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2035
Entry
SPUL_2035         CDS       T01740                                 

Gene name
pflB
Definition
(GenBank) formate acetyltransferase 1
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00620  Pyruvate metabolism
sel00640  Propanoate metabolism
sel00650  Butanoate metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPUL_2035 (pflB)
   00640 Propanoate metabolism
    SPUL_2035 (pflB)
   00650 Butanoate metabolism
    SPUL_2035 (pflB)
Enzymes [BR:sel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SPUL_2035 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AET54361
Position
2034702..2036984
AA seq 760 aa
MSELNEKLATAWEGFTKGDWQNEVNVRDFIQKNYTPYEGDESFLAGATDATTKLWDSVME
GVKQENRTHAPVDFDTSVASTITSHDAGYINKALEKIVGLQTEAPLKRAIIPFGGIKMVE
GSCKAYNRELDPMIKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIG
DYRRVALYGIDYLMKDKFAQFTSLQSDLENGVNLEATIRLREEIAEQHRALGQIKEMAAK
YGCDISGPATNAQEAIQWTYFGYLAAVKSQNGAAMSFGRVSTFLDAYIERDLKAGKITEQ
DAQEMIDHLVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGVDGRTLVTKNSFRFLNT
LYTMGPSPEPNITVLWSEKLPLNFKKFAAKVSIDTSSLQYENDDLMRPDFNNDDYAIACC
VSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKSEPIKGDVLNFDEVMDRM
DHFMDWLAKQYVTALNVIHYMHDKYSYEASLMALHDRDVIRTMACGIAGLSVAADSLSAI
KYAKVKPIRDEDGLAIDFEIEGEYPQFGNNDARVDDMAVDLVERFMKKIQKLTTYRGAIP
TQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLTSVAKLPFAYA
KDGISYTFSIVPNALGKDDEVRKTNLAGLMDGYFHHEASIEGGQHLNVNVMNREMLLDAM
EHPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQTM
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgtccgagcttaatgaaaagttagccacagcctgggaaggttttaccaaaggtgactgg
cagaatgaagtaaacgtccgtgacttcattcagaaaaactacactccgtatgagggtgac
gagtccttcctggctggcgctactgacgcgaccaccaagctgtgggacagcgtaatggaa
ggcgttaaacaggaaaaccgcactcacgcgcctgttgactttgacacctccgttgcttcc
accatcacttctcacgacgctggctacatcaacaaagcgcttgagaaaattgttggtctg
cagactgaagctccgctgaagcgtgcgattatcccgttcggcggcatcaaaatggttgaa
ggttcctgcaaagcgtacaatcgcgagctggacccaatgatcaaaaaaatcttcaccgaa
taccgtaagactcacaaccagggcgtgttcgacgtttatactccggacatcctgcgttgc
cgtaaatccggcgttctgaccggtctgccggatgcgtatggccgtggccgtatcatcggt
gactaccgtcgcgtagcgctgtacggtatcgactacctgatgaaagacaaattcgcacag
tttacgtctctgcaatccgatctggaaaacggcgtaaatctggaagcgactatccgtctg
cgtgaagaaatcgctgaacagcaccgcgctctgggtcagatcaaagaaatggcagctaaa
tacggctgcgatatctctggtccggcgactaacgctcaggaagcaatccagtggacttac
ttcggttacctggctgcggttaaatctcagaacggcgcagcaatgtccttcggtcgtgta
tccaccttcctggatgcgtacatcgaacgtgacctgaaagcaggcaaaatcaccgagcaa
gacgcacaggaaatgattgaccacctggtcatgaaactgcgtatggttcgcttcctgcgt
actcctgaatatgatgaactgttctccggcgacccgatttgggcaaccgaatctatcggc
ggtatgggcgttgatggccgtactctggtcaccaaaaacagcttccgtttcctgaacacc
ctgtacaccatggggccgtctccggagccgaacatcaccgttctgtggtctgaaaaactg
ccgctgaacttcaagaaattcgccgctaaagtctccatcgacacctcttctctgcagtac
gagaacgatgacctgatgcgtccggacttcaacaacgatgactacgctatcgcatgctgc
gtaagcccgatgatcgttggtaaacaaatgcagttcttcggcgcgcgtgcaaacctggcg
aaaaccatgctgtacgctatcaacggcggcgttgatgaaaaactgaaaatgcaggttggt
ccgaaatccgaaccgatcaaaggcgatgttctgaacttcgacgaagtgatggatcgcatg
gatcacttcatggactggctggctaaacagtatgtcaccgcgctgaacgttatccactac
atgcacgacaagtacagctacgaagcctctctgatggcgctgcacgaccgtgacgttatc
cgcaccatggcgtgtggtatcgcaggtctgtccgttgctgctgactccctgtctgccatc
aaatatgcgaaagttaaaccgattcgtgacgaagatggtctggctatcgacttcgaaatc
gaaggcgaatacccgcagtttggtaacaacgacgctcgtgtagatgacatggcggttgac
ctggtagaacgtttcatgaagaaaattcagaaactgaccacctaccgtggcgctatcccg
acgcagtctgttctgaccatcacttctaacgttgtgtatggtaagaaaaccggtaacacc
ccggatggtcgtcgcgctggcgcgccgttcggaccaggtgctaacccgatgcacggtcgt
gaccagaaaggcgctgtcgcttctctgacctccgttgctaaactgccgtttgcttacgcg
aaagatggtatttcttataccttctctatcgttccgaacgcactgggtaaagacgacgaa
gttcgtaagactaacctggcaggtctgatggatggttacttccaccacgaagcgtccatc
gaaggcggtcagcacctgaacgtcaacgtcatgaaccgtgaaatgctgctggacgcgatg
gaacatccggaaaaatatccgcagctgaccatccgtgtatctggttacgcagtacgtttt
aactccctgacgaaagaacagcagcaggacgttattactcgtaccttcacgcagaccatg
taa

DBGET integrated database retrieval system