KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2036
Entry
SPUL_2036         CDS       T01740                                 

Definition
(GenBank) putative sopD2 type III secretion system effector protein
  KO
K23936  secreted effector protein SopD2
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sel00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    SPUL_2036
SSDB
Motif
Pfam: SopD
Other DBs
NCBI-ProteinID: AET54362
Structure
PDB: 
5CQ9

Position
complement(2037060..2038019)
AA seq 319 aa
MPVTLSFGNRHNYEINNSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLI
HGCKRENQAELNVDITGMEKIHAFTQLKQYANPSQQDRFVMRFDMNQTQVLFEIDGKVID
KCNLHRLLNVSENCIFKVMEEDEEELFFKVCIKYGEKIARYPELLEGFANKLKDAVNEDD
DVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGE
VLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYR
SHNNTLFISEKSSCRNMLI
NT seq 960 nt   +upstreamnt  +downstreamnt
atgccagttacgttaagttttggtaatcgtcataactatgaaattaataattcacggcta
gcccgtttgatgagtcctgataaagaagaagcgctatacatgggggtatgggatagattt
aaggactgcttcagaacacacaaaaaacaagaggtgctggaggtattatatacactcatc
catggatgtaaacgtgaaaatcaagctgaacttaatgttgatataaccggcatggagaag
atacatgcctttacacaattaaaacaatatgctaatccatctcaacaagaccgctttgtt
atgcgttttgatatgaatcagacacaagttttatttgagattgatggcaaggttattgat
aaatgtaatttgcatcgtctcctcaatgtttcagaaaactgtatttttaaagtgatggaa
gaagatgaagaagagttgttttttaaagtatgtattaagtatggagaaaaaattgcccgc
tatccagaattattagaaggatttgctaataaacttaaagatgcagttaatgaggatgat
gacgttaaggatgaagtttataagcttatgcgatctggagaagatcgaaaaatggaatgt
gttgaatggaatggtactcttactgaagaggagaagaataaactacgctgtcttcaaatg
gggtcttttaatattactacccaattttttaaaataggttactgggaattagagggggaa
gtcctgtttgatatggttcatccaacacttagctatctgctacaagcatataaaccgtca
ttgtcatctgatttaatagaaactaacaccatgctgttttctgatgtattaaataaggat
tatgatgattatcaaaataataaaagagaaattgatgctattctaagaagaatatataga
tcacataataacactttatttataagtgaaaagtcgagttgtcgcaatatgcttatataa

DBGET integrated database retrieval system