KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2037
Entry
SPUL_2037         CDS       T01740                                 

Definition
(GenBank) putative conserved hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54363
Position
complement(2038318..2038467)
AA seq 49 aa
MWLFQNVLQWSYFTSIQYKIYGKSMLHNSHRQKFWLIHQLVTPQPQYIL
NT seq 150 nt   +upstreamnt  +downstreamnt
gtgtggctgttccagaatgtgctgcaatggagctattttacctctattcagtataaaata
tacggcaaatctatgctgcataactcgcaccgccagaaattctggctcattcatcagctc
gtaacgcctcaaccgcaatacatactgtaa

DBGET integrated database retrieval system