KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2039
Entry
SPUL_2039         CDS       T01740                                 

Gene name
ycaM
Definition
(GenBank) putative transport protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-ProteinID: AET54365
Position
complement(2039685..2041106)
AA seq 473 aa
MPNVQEKQLRWYNIALMSFITVWGFGNVVNNYANQGLVVVFSWVFIFALYFIPYALIVGQ
LGSTFKEGKGGVSTWIKHTMGPGLAYLAAWTYWVVHIPYLAQKPQAILIALGWALKGDGS
LIKEYTVVALQGLTLALFVFFMWVASRGMKSLKVVGSVAGIAMFIMSILYVVMAVTAPAI
TNVEIATTNITWQSFIPHIDFTYITTISMLVFAVGGAEKISPYVNQTRNPGKEFPKGMLF
LAVMVAVCAILGSLAMGMMFDSRHIPDDLMTNGQYYAFQKLGEYYHMGNSLMVIYAIANT
LGQIAALVFSIDAPLKVLLGDADTKYIPQRLCRTNASGTPVNGYLLTLVLVAILIMLPTL
GIGDMNNLYKWLLNLNSVVMPLRYLWVFVAFIAVIRLAQKYKPEYVFIRNRALALTVGIW
CFAFTAFACLTGIFPKMEAFTPEWTFQLTLNIVTPFVLVGLGLIFPLLARRNT
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgccgaatgtgcaggaaaaacagttgcgatggtacaacatcgccctgatgtcgtttatt
accgtttggggattcggcaatgttgtcaataactatgctaaccaggggttagtggttgtc
ttctcctgggtgtttatttttgcgctctatttcattccttatgccttaatcgtggggcaa
ctgggctcaaccttcaaagagggaaaagggggcgtcagtacctggattaagcatacgatg
gggccggggttggcttaccttgcggcatggacctattgggtcgtgcatattccctacctg
gcgcaaaagccgcaggcgatactcattgcattgggatgggctttaaaaggcgacggctcg
ttgataaaagaatataccgtcgttgccttgcaggggctgacgctggcattgtttgttttc
tttatgtgggttgcttcccgggggatgaaatcgctaaaggttgttgggtctgtggccggg
attgccatgtttatcatgtcaattttatatgttgtgatggcagtgaccgcgccagcaatt
acaaacgttgaaattgcgaccactaacatcacctggcagtcatttattcctcatatcgat
tttacctatatcaccaccatctctatgttggtctttgcggttggtggggcagagaagatc
tcgccttatgtcaaccagacgcggaatccaggaaaagaatttccgaaggggatgctcttt
ttagccgtcatggttgcggtctgcgctatcctcggttcgttggcgatgggaatgatgttt
gattcgcggcatatacctgacgatttaatgactaatgggcaatattatgcattccagaaa
ttgggtgagtattaccatatgggtaattcattaatggtgatttatgccattgccaatact
ctggggcaaatcgccgcgctggtgttttctattgatgcgccactgaaagttttactgggt
gatgcagacactaaatatatcccgcagcgcttatgtcgtactaacgcttcaggtacgcct
gttaacggttatttgctgacattagtgttggtcgctatcttgattatgttgccaacgctt
ggcatcggcgatatgaacaacctgtacaaatggctgcttaatctcaattcagtcgttatg
ccgctgcgctatctgtgggtatttgtcgcctttattgccgtcattcgactggcgcaaaag
tacaaacccgaatatgtgtttattcgcaaccgggcgttggcgttaactgtgggaatatgg
tgttttgccttcaccgcgtttgcctgccttaccggtattttccccaaaatggaggcgttc
acgccggagtggacattccagctgacgttgaacatcgtgacgccttttgtcctggtcggg
ttgggattaattttcccactgctggcgcgtagaaacacataa

DBGET integrated database retrieval system