KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2071Help
Entry
SPUL_2071         CDS       T01740                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00260  Glycine, serine and threonine metabolism
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01120  Microbial metabolism in diverse environments
sel01130  Biosynthesis of antibiotics
sel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPUL_2071 (ltaA)
Enzymes [BR:sel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SPUL_2071 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AET54396
Position
2080932..2081933
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMTAPVGDDVYGDDPTVNALQRYAADLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLENVAAKI
KADDIHFARTRLLSLENTHNGKVLPRAYLKDAWTFTRERGLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRATRWRKMVGGGMRQAGILAAAGLY
ALKHNVARLQEDHDNAAWLAQQLREAGAEVMRHETNMLFVRVGEAQAAALGDYLRERNIL
INAAPSVRLVTHLDVSREQLADVVAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgggccgcgccatgctcgaggcgatg
atgaccgccccggtcggggacgacgtatacggcgatgaccctactgttaacgcccttcag
cgctacgccgccgacctttccggtaaagaagcggcgctttttttacccaccggcacccag
gccaatctggtcgcgctgcttagccattgtgaacgcggcgaagagtatatcgtcggtcag
ggcgcgcataattatctttatgaagctggcggcgcggcggtgctcggcagcattcagccg
cagcccatcgacgccgccgcggacggtacgctgccgctggagaacgtggcggcgaagatt
aaagcggatgacatccacttcgcgcgcacgcgcttgctcagtctggaaaatacgcataac
gggaaagtgctgccgcgcgcgtatctgaaagacgcctggacatttacccgcgaacgtgga
ctggcgctgcacgttgacggcgcccgaatttttaacgcggtggttgcctacggttgtgag
ttaaaagagattacgcagtattgcgactcttttaccatctgcctgtcaaaaggtctcgga
acgccggtcggttcgctgctggtcggcaaccgcgattacattaaacgcgcgacgcgctgg
cgtaaaatggtcggcggcggaatgcgtcaggccgggattctggcagcggccggactgtat
gcgctgaagcataacgtggcgcgtctgcaagaggaccatgataacgccgcctggctggcg
cagcagcttcgcgaagcgggcgcggaggtcatgcgccacgaaacgaatatgctgtttgtt
cgcgttggcgaagcacaggccgccgcgcttggcgactatttgcgggaacggaatatcctg
attaacgccgcgccgagtgtgcgtctggtgacgcatctggatgtttctcgcgaacagctt
gccgacgtcgtcgcccactggcgcgcctttttagcccgctaa

DBGET integrated database retrieval system