KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2337Help
Entry
SPUL_2337         CDS       T01740                                 

Gene name
dpiB
Definition
(GenBank) sensor kinase DpiB
  KO
K07700  two-component system, CitB family, cit operon sensor histidine kinase CitA [EC:2.7.13.3]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPUL_2337 (dpiB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sel01001]
    SPUL_2337 (dpiB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sel02022]
    SPUL_2337 (dpiB)
Enzymes [BR:sel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SPUL_2337 (dpiB)
Protein kinases [BR:sel01001]
 Histidine kinases
  CitB family [OT]
   SPUL_2337 (dpiB)
Two-component system [BR:sel02022]
 CitB family
  CitA-CitB (citrate fermentation)
   SPUL_2337 (dpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c HATPase_c_5 SPOB_a PAS_8 PAS HATPase_c_2 PAS_4 dCache_1 PAS_9 HATPase_c_3 HemY_N dCache_3 PAS_7 sCache_3_3
Motif
Other DBs
NCBI-ProteinID: AET54649
Position
complement(2342832..2344493)
Genome map
AA seq 553 aa AA seqDB search
MSYQKNKKLFPFFRQLAFPLRIFLLILVVSVFIVAALAQYLSASFEDYLASHVRDMAMNQ
AKIIASNDSIIAAVKNRDYKRLAIIANKLQRGTDFDYVVIGDRHSIRLYHPNPEKIGYPM
QFTKPGALERGESYFITGKGSIGMAMRAKTPIFDNKGNVIGVVSIGYLVSKIDSWRLDFL
LPMAGVFVLLLVVLMLLSWFFAAHIRRQMLGMEPKQIARVVRQQEALFSSVYEGLIAVDP
EGHITAINRSARKMLGLPSPGRQWLGKLIAEVVNPADFFTCQIAERRQDVMANFNGLSVI
ANREAIRSGEELLGAIISFRSKDEIATLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLL
QMKEYDRVREMVQGESQAQQQLIDSLLGAFADRQVAGLLFGKVQRARELGLKMVIVPGSQ
LHQLPEGLDSTEFAAIVGNLLDNAFEASLRTQEGDNTIELFLSDEGDEVVIEVADQGCGV
PEALREKIFEQGVSTRTDEPGEHGIGLYLIASYVGRCGGVITLEDNDPCGTLFSLFLPKV
KKNDDRTINPIDR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcagaaaaataaaaagctgtttcctttttttcggcaactcgcgtttccgtta
cgtatttttctgctcattctggtggtttctgttttcatcgtggcagcgttagcacaatat
ttgtctgccagtttcgaagattatctggcgtcccatgttcgtgatatggcgatgaatcag
gcaaaaattattgcttctaacgacagcattatcgctgccgtaaaaaaccgggactataaa
cgcctggcgataattgcgaataaactgcagcgcgggacggattttgactatgtggtgata
ggcgatcgccactcgatccggctttaccatccgaatccggaaaaaatcggctatcccatg
cagtttacgaaacccggcgcgctggaaagaggagaaagttatttcattaccggtaagggc
tcaatagggatggcgatgcgcgccaaaacgcctatctttgacaacaaaggcaacgtgatc
ggcgttgtttcaattggctatctggtcagtaaaatcgactcctggcggctggacttctta
ttaccgatggcgggggtttttgtcctgttgctggtggtattaatgctgctttcctggttt
ttcgccgcgcatatccgccgacaaatgctgggcatggagccgaaacagattgcgcgcgtg
gtacgccagcaggaggcgttgtttagctcggtttatgaagggctgatcgccgttgatccg
gagggacatattaccgcgattaaccgcagtgcgagaaaaatgttggggctgccgtcgccg
gggcgtcagtggctgggcaagctgatcgcggaagtcgtcaatccggcagacttttttacc
tgccagatcgcagaaagacgccaggacgtgatggccaacttcaatggcctgagcgtcatc
gccaatcgtgaggctatccgttccggcgaggagctgctgggcgctattattagttttcgc
agcaaagatgaaatcgcgacgttgaacgcgcagctaacccagattaaacagtatgttgag
agcctgcgcacgctacgccatgagcacctgaactggatgtcgactctgaacggcctgctg
caaatgaaagagtatgatcgggtcagagagatggtgcagggcgaatcgcaggcgcagcag
caacttattgatagtttactcggcgccttcgccgatcgtcaggtggccggtttgctgttt
ggcaaagttcagcgcgcgcgtgaactggggctcaagatggtgattgttcccggcagccag
ctacatcaactgccggaggggctggatagcacggagttcgccgccatcgtcgggaatctg
ctggataacgcgtttgaggcgagtttgcgtacacaggaaggcgacaataccatcgaactt
ttcctgagcgacgagggcgacgaggtggtgatagaggtcgccgaccagggctgcggcgtt
cctgaagcgctgcgggaaaaaatttttgaacagggcgtaagtacccgaaccgacgaaccc
ggtgagcatggtatcgggttatatctgattgcaagttatgtggggcgctgtggcggggtc
attacgctggaagacaatgatccttgtggcaccttattttctttattccttccgaaagtg
aaaaaaaacgatgacagaaccattaaccctattgatcgttga

DBGET integrated database retrieval system