KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2919Help
Entry
SPUL_2919         CDS       T01740                                 

Definition
(GenBank) putative decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00130  Ubiquinone and other terpenoid-quinone biosynthesis
sel00627  Aminobenzoate degradation
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01120  Microbial metabolism in diverse environments
sel01220  Degradation of aromatic compounds
Module
sel_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SPUL_2919
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SPUL_2919
Enzymes [BR:sel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SPUL_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AET55200
Position
2925205..2925798
Genome map
AA seq 197 aa AA seqDB search
MRLIVGMTGATGAPLGVELLQALRAIPDVETHLVMSKWAKTTIELETPYTPAEVAALADY
CHSPADQAATISSGSFRTDGMIIIPCSMKTLAGVRAGYAEGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAIVPPMPAFYNLPQTVDDIIQHIVARVLDQFGLEHTRT
RRWQGLRQAANFSQENG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattgtggggatgaccggtgcgaccggcgcgccgcttggcgtcgagctactc
caggcattgcgggcgatacctgatgttgaaacgcatctggtaatgtcaaagtgggcgaaa
accactattgaactagagacgccctacacgcccgctgaggtagccgccctggcagattat
tgtcatagcccggccgatcaggcggcgaccatttcctccggctcatttcgtaccgacggc
atgattattatcccctgcagtatgaaaacactggcgggggttcgcgccggctatgccgag
gggctggtgggacgcgctgccgatgtcgtgttgaaagagggtcgcaagctggtgcttgtg
ccgcgggaaatgccgctcagcacgattcatctggaaaacatgctagcgctttctcgtatg
ggggtggcgatagtgccgcccatgcccgccttctacaacctgccgcaaaccgttgacgat
attatccagcacatcgtagcgcgcgttctcgaccagtttggtctggagcatacgcgcacg
cgccgctggcaaggactgcgacaggcagcaaatttttcacaggagaatggataa

DBGET integrated database retrieval system