KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2973Help
Entry
SPUL_2973         CDS       T01740                                 

Gene name
yqcB
Definition
(GenBank) putative RNA pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sel03016]
    SPUL_2973 (yqcB)
Enzymes [BR:sel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     SPUL_2973 (yqcB)
Transfer RNA biogenesis [BR:sel03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    SPUL_2973 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AET55248
Position
complement(2980881..2981663)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHLFTGQPLMIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHQA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacagacccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggctgtaacgcagtatcgcggactggcgacggtcgaaatggcggtaccg
accgggcgttatcccaccacgcgttatggtctggttgagctagaaccaaaaacgggacgt
aagcaccagctccgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcggcttgagctgacgcacctcttcaccggacagccgttgatgattcag
gccgggttggatgaaacctggatgcaggcgctgacacagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatcaggca
taa

DBGET integrated database retrieval system