KEGG   Selenomonas sp. oral taxon 478: ADJ74_06850Help
Entry
ADJ74_06850       CDS       T04017                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sele  Selenomonas sp. oral taxon 478
Pathway
sele00471  D-Glutamine and D-glutamate metabolism
sele00550  Peptidoglycan biosynthesis
sele01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sele00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ADJ74_06850
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADJ74_06850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sele01011]
    ADJ74_06850
Enzymes [BR:sele01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     ADJ74_06850
Peptidoglycan biosynthesis and degradation proteins [BR:sele01011]
 Precursor biosynthesis
  Amino acid ligase
   ADJ74_06850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase NAD_binding_8 AlaDh_PNT_C Pyr_redox_2 DAO Pyr_redox_3 FAD_binding_3 Pyr_redox GIDA FAD_binding_2 adh_short_C2 HI0933_like 3HCDH_N FAD_oxidored Shikimate_DH Thi4 YjeF_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AKT54178
UniProt: A0A0K1FI12
Position
1:1461962..1463344
Genome map
AA seq 460 aa AA seqDB search
MSYHNQSALVIGAGISGFAAAKYLAAQGARVVLSDAKDETDAERDPLTQQHIEDLRAQGI
TCVFGAQREELLGGVDLLVLSPAVPERIPLVQAARARGIRVTTEVELAGEIARAPICAIT
GTNGKTTTTTLLGELLHAHFPVVGVGGNIGVPLIDVAQKTPAEGAIAAEISSYQMEATTH
FHAHIVAELNITPDHIVRHGSMEVYQAMKEKLFAAQTAEDYLVLNADDPHTRGMAERAAG
RVCLFSRREELAEGACVRADGMIVIRWDGAEHVLIPADELGIPGAHNVENVLAASAMALF
AGVTPAEMRPVLRAFKGVEHRIEFVRALAGVSYYNDSKATNTDSAIKALEAFDGHIILIA
GGDDKLTDLGEFMELVHARVDELILVGDAAERFAAAARDAGIPEEQIHCVGYHMEKAVHL
ARELAVEGQIVLLSPACASFDMYGGYEERGRDFKRLVNEL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctatcataatcagtcggcactcgtcatcggcgcgggtatcagtggatttgcggcg
gcaaagtatctggcggctcagggcgcacgggtggtgctctcggacgcaaaggacgagacg
gacgccgaacgcgatccgctcacccagcagcatattgaggatttaagggcgcagggcatc
acctgcgtctttggtgcacaaagggaagaactgctcggcggggtggatctcctcgtcctt
tcccctgccgtgcccgagcgcatccccctcgtacaggcggcgcgcgcgcgcggcatccgc
gtcacgaccgaggtggagctggcgggcgagatcgcccgtgcgccgatctgcgccatcacg
gggacgaacggcaagacgacgacgacgaccctgctcggcgagcttctgcacgcgcatttt
cctgtggtcggcgtgggcggcaacatcggcgttccactcatcgacgtggcacagaagacg
ccagccgagggagcaattgccgctgagatctcaagctatcagatggaagcgaccacgcat
tttcatgcacacattgtcgcggagctgaacatcacgccggatcacatcgtgcgccatggc
tcgatggaggtctatcaggcgatgaaggaaaagctcttcgccgcgcagacggcggaggac
tatctcgtactgaacgccgatgatccgcacacgcgcggcatggcagagcgcgcggcgggg
cgcgtctgcctgttcagccgcagggaggaactggcggagggggcgtgcgtccgtgcggac
ggcatgatcgtcattcgctgggacggtgcggagcacgtcctgattcccgccgatgaactg
ggcatccccggtgcgcataacgtggaaaacgtactcgcggcgtcggcgatggcgctcttt
gccggagtgacgcccgcggaaatgcgccccgttctgcgcgccttcaagggcgttgagcac
cgcatcgagtttgtgcgcgcactcgcgggggtcagctactacaacgactcgaaggcgacg
aatacggactccgcgatcaaggcacttgaggcgttcgacggacacatcatcctcatcgcg
ggcggcgacgacaagctgaccgatctgggggagtttatggagcttgtgcacgcgcgcgtc
gatgagctgatcctcgtcggtgatgcggcagagcggtttgcggcggcggcacgggatgcg
ggcattccggaggaacagatccactgtgtcggctatcacatggagaaggccgtgcatttg
gcgcgcgagctcgcagtggaggggcagatcgtcctcctctcgcctgcctgtgcgagcttt
gatatgtatggcggctacgaggagcgcgggcgcgatttcaagaggcttgtgaacgaacta
tga

DBGET integrated database retrieval system