KEGG   Selenomonas sp. oral taxon 478: ADJ74_09830Help
Entry
ADJ74_09830       CDS       T04017                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sele  Selenomonas sp. oral taxon 478
Pathway
sele00620  Pyruvate metabolism
sele01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sele00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ADJ74_09830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sele02000]
    ADJ74_09830
Enzymes [BR:sele01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     ADJ74_09830
Transporters [BR:sele02000]
 Other transporters
  Primary active transporters [TC:3]
   ADJ74_09830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like DUF561
Motif
Other DBs
NCBI-ProteinID: AKT54713
UniProt: A0A0K1FJI9
Position
1:complement(2118233..2119621)
Genome map
AA seq 462 aa AA seqDB search
MAKNPVKITETVLRDGHQSLVATRMRISDMLPQLAALDAIGYNALEAWGGATFDTCLRFL
DEDPWERLDILKKNLKTPIQMLLRGQNLLGYNHYSNDVVEKFVQKASAHGVGVFRIFDAL
NDIRNLRVAIDSALKCPEKPHVQGCLVYTISPVHTNESFVELAVELEKMGCHSVCIKDMS
GLLKPYVAEDLVKKLKAAVKIPIDLHTHCTSGFGHATYLKAIEAGVDIIDTALAPFSSDT
SQPCTETMVAMLEGEERDTGLDRQAMTPISKYFLKVKQDLIKTFNLKGYFDVNPNVLDFQ
IPGGMLSNLANQLKEAGMEDKYQDLLDEMPRVRKDVGYPPLVTPSSQIVGTMATFNVMSG
QRYKMVPNEFKDLARGKFGRTPVEVDRKFLTDTLGIAPEDIIEDCSIEDAKAKTFDEFKE
ELKGKGYLNPTDEDVLSYALFPQVAEEFFKAHYKPITAYVKE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaatccggtcaaaattaccgagactgtcctccgcgacggacatcagtcgttg
gtagcaacgcgcatgcgcatttcggacatgcttccgcagcttgcggcgcttgatgccatc
ggctacaatgctcttgaggcatggggcggtgccacatttgacacatgccttcgtttcctc
gatgaggacccgtgggagcgcttggatattctgaagaagaaccttaagacgccaattcag
atgctccttcgtggccagaacctgcttggatacaatcattattccaacgatgttgttgaa
aaatttgtccagaaagcatctgcacacggcgtcggtgtcttccgcatctttgatgcattg
aacgatatccgcaacctgagggttgctattgattcggctctgaaatgcccggagaaaccg
catgtccagggttgccttgtatatacgatcagcccggttcacacaaacgaaagctttgtt
gaattggctgtcgagctcgagaagatgggatgtcattccgtctgcatcaaggacatgtca
ggcctgctgaagccatatgttgctgaggatctggtcaagaagctcaaagcagcggtgaag
atccccatcgatctccatacacactgcacctctggatttggtcatgcaacgtatctgaaa
gccatcgaggcgggtgttgatatcatcgatacagcactggctcccttctccagcgacaca
tctcagccgtgtactgaaacgatggttgcgatgctggaaggagaagagcgtgataccggg
cttgaccgtcaggcaatgacgccgatctccaagtacttcctcaaggtaaagcaggatctc
attaagacgttcaaccttaagggatactttgacgtcaatccgaacgtgttggatttccag
attcctggcggtatgctttccaatcttgctaaccagctcaaagaagccggcatggaagac
aagtaccaggatcttctcgacgagatgccgcgcgtacgcaaagatgtcggttatccgccg
ctcgttaccccctcttctcagatcgttggaactatggcaacgtttaacgttatgagtggc
cagcgttacaagatggtgccgaatgagttcaaggatcttgctcgtggaaaattcggcaga
acccccgttgaggtcgatcgtaagttcctgaccgatacgcttgggattgctccggaggat
atcatcgaggactgctcgatcgaagatgcaaaggcaaagacattcgacgagtttaaggaa
gaactgaaaggaaaaggatatctcaatccgaccgatgaggatgttctctcctatgctctc
ttcccgcaagttgcggaggagttcttcaaggcacactacaagccgattacggcatacgta
aaagagtaa

DBGET integrated database retrieval system