KEGG   Selenomonas sp. oral taxon 136: AXE86_07735Help
Entry
AXE86_07735       CDS       T04745                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
selo00670  One carbon pool by folate
selo01100  Metabolic pathways
selo01120  Microbial metabolism in diverse environments
selo01200  Carbon metabolism
Module
selo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:selo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AXE86_07735
Enzymes [BR:selo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AXE86_07735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: AME03971
UniProt: A0A109WDI1
Position
1616638..1618302
Genome map
AA seq 554 aa AA seqDB search
MKSDVEIAREAKLRPITEIAATLGIDADTIEPYGRYKAKLTRESLAGAHGKQGKLILVTA
INPTPAGEGKTTTSVGLADALHRQGKKTIVALREPSLGPCFGMKGGAAGGGYAQVVPMED
INLHFTGDFHAITTAHNLLAALIDNHIFQGNPLDLDVNRIVWKRVLDINDRALRHVVTGL
GGRVHGVPRESGFDITVASEMMAILCLAEDLADMKRRLGRILIGYTRGGRPVHAEEIGAT
GALTLLFKDAVKPNLVQTIEGTPALIHGGPFANIAHGCSSVAATKAALRCADYVVTEAGF
GADLGAEKFFDIKCRLAGLTPDAVVIVATVRALKMNGGAAKSDLGTENLDALQRGAANLE
KHIENIGKFGVPAVVAVNVFPTDTEAELALLEELCARLGAPAVRSEVWAKGGEGGLAMAD
AVDAALRQPAHFHPIYDAEKPIAEKIETIAREIYGADGVDFTDAAKKQLVEMDALGMTET
PVCMAKTQYSFSDNPELLGRPSGFRITVRELRASCGAGFVVALTGNVLTMPGLPKVPAAM
GMDITADGVITGLF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgatgtcgaaatcgcgcgcgaagccaaacttcgccccattacagaaattgcg
gccacgctgggcattgatgcggatacgatcgagccgtacggcaggtacaaggcaaagttg
acgcgcgaatcccttgcgggcgcccatggaaaacagggaaagctcatcctcgtcacggcg
atcaacccgacccccgcaggtgagggcaagacgacgacgagcgtcgggcttgccgatgcc
ctccatcggcagggcaaaaagaccatcgttgccctgcgcgagccgtcgctcggcccatgc
ttcggcatgaagggcggcgcggcgggcgggggctatgcgcaggtcgtccccatggaggac
atcaacctccactttacaggggactttcacgccatcacgacggcgcacaaccttcttgcc
gcactcatcgacaaccacatctttcagggcaacccactcgatctcgacgtgaaccgcatc
gtgtggaagcgcgttctcgacatcaacgaccgcgccctgcgtcacgtcgtcacggggctc
ggcgggcgcgtccacggcgtgccgcgggagtccggctttgacatcaccgtcgcctcggag
atgatggcgatcctctgtctggcggaggacctcgccgacatgaagcggcgccttgggcgc
atcctcatcggctatacgcgcggcggacgtcccgtgcacgcggaggagatcggtgcgacg
ggggccttgaccctcctctttaaggatgccgtgaagcccaacctcgtgcagaccatcgag
gggacacccgccctcatccacggcggccccttcgcgaacatcgcccatgggtgcagcagc
gtcgcagcgaccaaggcagcactgcgctgtgcggactacgtcgtcacggaggcaggcttc
ggtgcggatctcggcgcggagaaattcttcgacatcaaatgccgccttgcggggctcacc
cccgatgccgtcgtcattgtcgccaccgtgcgtgcgctcaagatgaacggcggcgcggca
aagagtgacctcggcacggagaatctggacgccctgcagcgtggcgcggcgaacctcgaa
aagcacatcgagaacatcggaaagttcggcgtgcccgccgtcgtcgccgtcaacgtattt
ccgacggacaccgaggcggagctcgctctcctcgaggagctctgcgcgcgcctcggtgca
cctgccgtgcgctccgaggtctgggcaaagggcggcgagggcggacttgccatggcagat
gcggtagacgcagcactccggcagccggcgcattttcaccccatctacgatgcggaaaag
cccatcgcggagaagatcgagaccatcgcgcgggagatctacggcgcggacggcgtggac
tttaccgatgcagcaaagaagcagctcgtggagatggatgcgctcggcatgacggagaca
cccgtctgcatggctaagacgcagtactccttctccgacaaccccgaactcctcggacgt
ccgtcgggcttccgcatcactgtgcgcgagctgcgcgcctcctgcggagcgggcttcgtc
gtcgccctcacgggcaatgtcctcaccatgccgggactgccgaaagtgcccgccgcgatg
ggcatggacatcacggcggacggtgtgatcacgggactgttctaa

DBGET integrated database retrieval system