KEGG   Selenomonas sp. oral taxon 920: BCS37_02420Help
Entry
BCS37_02420       CDS       T04818                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
selt  Selenomonas sp. oral taxon 920
Pathway
selt00051  Fructose and mannose metabolism
selt01100  Metabolic pathways
selt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:selt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BCS37_02420
Enzymes [BR:selt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BCS37_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AOH47366
UniProt: A0A1B3X2E2
Position
complement(526380..527024)
Genome map
AA seq 214 aa AA seqDB search
MLEQIKEDVLRCALEADHAGLCRHRSGNFSIRDAASGHICITPTGMDREEMTADDIVVID
MDGRAVESLNDRKPTSELMMHTAIYRSRSDVLAVAHTHSRAATAFAVMNKPIPAIVYELS
ILGCKEGYVPVAPYGRPGTRAAAENVLAPLTISDVALMQAHGVVAVAGSLKEALLKASYV
EELADIYHRCLTVLGHEPDTISADELAKWKYPTV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaacaaatcaaagaggacgtgctccgctgtgcactcgaagcggatcatgcgggc
ctgtgtcggcaccgttcgggaaatttcagcatccgcgacgcagcgagcggacacatctgc
atcacgccgacgggcatggatcgcgaagagatgaccgcagacgacatcgtagtcattgat
atggacggacgcgcagtcgagtcactgaatgaccgaaagcccacgagcgaactgatgatg
cacacggcaatctatcggagccgcagcgatgtcctcgctgtcgcgcacacccattcgcgc
gcagcgaccgcattcgccgtcatgaacaagccgattcccgccatcgtctacgagctctcc
atcctcggctgcaaggagggttatgttcccgtcgccccgtacggacgccccggtacgcgc
gcagcggcggaaaacgtacttgcgccgctcaccatctccgacgttgctctcatgcaggcg
cacggtgttgtcgccgtcgccggaagtctcaaggaagccctgctcaaggcaagctacgtc
gaagaactcgccgacatctaccaccgctgcctcaccgtcctcgggcacgagccagatacc
atctctgcggatgaactggcaaagtggaagtatccgacagtttag

DBGET integrated database retrieval system