KEGG   Selenomonas sp. oral taxon 920: BCS37_09405Help
Entry
BCS37_09405       CDS       T04818                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
selt  Selenomonas sp. oral taxon 920
Pathway
selt00270  Cysteine and methionine metabolism
selt00920  Sulfur metabolism
selt01100  Metabolic pathways
selt01110  Biosynthesis of secondary metabolites
selt01130  Biosynthesis of antibiotics
selt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:selt00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BCS37_09405
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BCS37_09405
Enzymes [BR:selt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BCS37_09405
    2.3.1.46  homoserine O-succinyltransferase
     BCS37_09405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS GATase
Motif
Other DBs
NCBI-ProteinID: AOH48644
UniProt: A0A1B3X638
Position
complement(1951192..1952139)
Genome map
AA seq 315 aa AA seqDB search
MPIKIPNNLPATNVLEGENIFVMNAARAYSQDIRPLRILILNLMPIKDVTETQLLRLLGN
TPLQVEVDFIYTESYIPTHTSRDYLTEFYGTFAEVRHKKYDGFIITGAPIEQLPFEHVAY
WDEVSEIMQWSRKHAYSTFHICWGAQAGLYYHYGIPKYWTDKKIFGVYEHRLCVQHEALL
RGFDDSFYVPHSRHTETRRADIERVPELTVLAEGDAGVYIIANLRRRQFFITGHAEYDPL
TLKAEYDRDLAAGLDPDIPCNYYPGDDPNRAPVVRWRSVAHLLFANWLNYYVYQGTPYEL
DSLDNADDWEYYSSL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaataccaaataatctgcctgcgacgaatgttctcgagggggagaacatc
ttcgtcatgaatgcggcacgcgcgtacagtcaggatattcgtccgctgcgcatactcatt
ctgaacctcatgccgatcaaggacgtgacagagacgcagctcctgcgtctcctcggcaac
acgcccctgcaggtcgaggtggacttcatctacacggagtcctatatccctacacacacg
tcgcgcgactaccttacggagttctacggaaccttcgccgaggtgcggcataagaaatac
gacggctttatcatcacgggagcaccgatcgagcagcttccgtttgagcacgtcgcttac
tgggacgaggtgtccgagatcatgcagtggagccgcaagcacgcttactccacgttccat
atctgctggggcgcacaggcgggcctttactaccactacggcatccccaaatactggacg
gacaagaagattttcggcgtctatgaacaccgcctctgcgtgcagcacgaggcgcttctg
cgcggcttcgacgacagcttctatgtaccgcattcacggcacacggagacgcggcgcgcg
gatattgaacgtgtgccggaactcaccgttctcgccgagggcgatgcgggcgtctacatc
atcgcgaatctgcgccgccgtcagttcttcatcacggggcacgctgagtacgatccgctg
acgctcaaggcggagtacgaccgcgatcttgccgccgggctcgatccggacattccgtgc
aactactaccccggggatgatccgaatcgcgcgcctgtcgtacgctggcgcagcgtcgca
catctccttttcgccaactggctgaactactacgtctatcagggtacgccgtacgagctg
gacagcctcgacaacgcggatgattgggaatactactccagtctgtaa

DBGET integrated database retrieval system