KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C01540Help
Entry
STMDT12_C01540    CDS       T01742                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00010  Glycolysis / Gluconeogenesis
sem00020  Citrate cycle (TCA cycle)
sem00620  Pyruvate metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01200  Carbon metabolism
Module
sem_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C01540 (aceF)
   00020 Citrate cycle (TCA cycle)
    STMDT12_C01540 (aceF)
   00620 Pyruvate metabolism
    STMDT12_C01540 (aceF)
Enzymes [BR:sem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STMDT12_C01540 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: BAJ35097
NITE: STMDT12_C01540
Position
178918..180807
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSAEGAADAAPAKAEEKKEAAPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVTAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPA
AKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagtggaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgaaggtgca
gccgacgctgcacctgctaaggcagaagagaagaaagaagcggcgccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagttcctgctccgtttgcaggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtctctaccggctctctgattatggtcttcgaagtggcg
ggtgaagcaggcgcagcagcaccagcgaaagcggaagccgctccggctgcggctgctcca
gcagcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggtcaaagtcggcgataaagttaccgctgaacagtcgctgatcacc
gtagaaggcgacaaagcctctatggaagttccggctccgttcgcgggtaccgtgaaagaa
atcaagatcagcaccggcgataaagtgaaaaccggttctctgattatggtcttcgaagta
gaaggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcgccggctccggcg
gcgaaagctgagaagcctgctgccccggctgcaaaagcggaaggcaaatctgagttcgct
gaaaacgacgcgtacgttcacgctactccgctgattcgccgtctggcgcgcgagtttggc
gtcaacctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagacgtt
caggcttacgtgaaagacgctatcaaacgcgcggaagctgcgccggctgctgcgggcggc
ggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaa
gaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtg
atgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgt
aaacagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtc
ttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctg
tccgaagacggtcagcgtctgaccctgaagaaatacatcaacatcggcgtggcggttgat
accccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgag
ctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggc
gaaatgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttc
gcgccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggaa
ccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttccttc
gaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatg
ttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system