KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C07950Help
Entry
STMDT12_C07950    CDS       T01742                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00020  Citrate cycle (TCA cycle)
sem00640  Propanoate metabolism
sem00660  C5-Branched dibasic acid metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01200  Carbon metabolism
Module
sem_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sem_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STMDT12_C07950 (sucC)
   00640 Propanoate metabolism
    STMDT12_C07950 (sucC)
   00660 C5-Branched dibasic acid metabolism
    STMDT12_C07950 (sucC)
Enzymes [BR:sem01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     STMDT12_C07950 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAJ35738
NITE: STMDT12_C07950
Position
844741..845907
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIGKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagccgaagaagccgcgtctaaaatcggcgct
ggcccgtgggtagtgaaatgtcaggttcacgctggcggccgcggcaaagcgggcggtgtg
aaggtagtaaaaagcaaagaagagattcgcgccttcgcggaaaactggctgggcaaacgt
ctggtgacctatcaaacagacgctaatggccaaccggtaaaccagattctggttgaagcg
gcgaccgacatcggcaaagaactgtacctcggcgcggtagttgaccgtagttctcgtcgc
gtggtctttatggcgtctaccgaaggtggcgtagagatcgaaaaagtcgcggaggaaacc
ccgcatctgatccataaagtcgcgctcgatccgctgaccggcccgatgccgtatcaggga
cgggaactggcgttcaaattgggtctggaaggtaaactggtgcagcagttcaccaaaatc
tttatgggtctggcaaccattttccttgagcgcgacctggcgctgatcgaaatcaacccg
ctggtgattactaagcagggcgatctgatttgcctcgacggcaagctgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgtgaccagtctcaggaagacccg
cgtgaagcgcaggcagcgcagtgggaactgaactacgtcgcgctggacggcaacatcggt
tgcatggtgaacggcgcgggtctggcgatgggcaccatggacatcgttaagctgcatggc
ggcgaaccggctaacttccttgacgtgggcggcggcgcaaccaaagagcgcgtcaccgaa
gcgtttaaaattatcctctcggatgacaacgtgaaagcggttctggttaacatcttcggc
ggtatcgtccgttgtgacctgattgccgacggtatcatcggcgcggtggaagaagtgggc
gtgaacgttccggtggtggtgcgtctggaaggcaacaacgccgaactcggcgcgaagaaa
ctggctgacagtggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system