KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C15400Help
Entry
STMDT12_C15400    CDS       T01742                                 

Definition
(GenBank) putative succinate semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00250  Alanine, aspartate and glutamate metabolism
sem00650  Butanoate metabolism
sem00760  Nicotinate and nicotinamide metabolism
sem01100  Metabolic pathways
sem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STMDT12_C15400
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STMDT12_C15400
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STMDT12_C15400
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     STMDT12_C15400
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     STMDT12_C15400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSD4
Motif
Other DBs
NCBI-ProteinID: BAJ36483
NITE: STMDT12_C15400
Structure
PDB: 

Position
1598873..1600261
Genome map
AA seq 462 aa AA seqDB search
MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDI
GQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLVENQQA
VIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILAEAG
TPAGVYGWVNANNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKMGDP
LVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVTPDMT
AFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatgactgcaacacaggcgttatccgtgaatcctgcgaccggccagacgctg
gcggcaatgccctgggctaacgcgcaagagattgaacatgcgctgagtctggcggcgagc
ggtttcaaaaagtggaaaatgacatcggtagcgcaacgggcgcaaacattacgcgatatt
ggtcaggcgcttcgcgctcatgcagaagagatggcgcaatgtattacgcgtgaaatgggt
aaacccataaagcaggcgcgtgcggaagtgacgaaatccgccgcgttatgcgactggtat
gcggaacatggcccggcaatgctgaatcctgagcctacgttggtagaaaatcagcaggcg
gtgattgaataccgtccgctgggcgtcattctggcgataatgccgtggaattttccttta
tggcaggtgttacgcggggcagtgccgatactgctggcggggaatagctacttgttaaaa
catgcgcccaatgtcacgggttgcgcgcagatgatagcccgaatcttggcggaagccggt
actcccgctggcgtctatggatgggtgaacgctaataatgagggcgtgagtcagatgatt
aacgatccgcgaatcgcggcggtgacggtgaccggtagcgtgcgcgccggcgcggcgatt
ggcgctcaggctggggcggcgctgaaaaagtgcgtactggaactgggtggctcggatccg
tttattgtactcaatgatgccgatctcgagttggcggtaaaagctgcggttgccggacgc
tatcaaaacaccggacaagtctgcgccgccgccaaacgttttattgtcgaagagggcatt
gcgcaggcgtttaccgatcgttttgtggcggctgccgcagcattaaagatgggtgatcct
ctggttgaagagaatgacctggggccgatggcgcgctttgatttgcgtgatgaactccat
caacaggtgcaggcttccgtcgccgaaggcgcacggctactgttgggcggggagaaaatc
gccggggagggcaactattatgccgcgaccgttctggcggatgttacacctgacatgacg
gcatttcgtcaggaactttttgggcctgttgccgccattaccgtcgcaaaagatgcggcg
cacgccctcgcgctggcgaatgacagtgagtttggcctgtcggcgacgatctttaccgcc
gacgatacgctggccgcggagatggcggcgcgtcttgagtgcggtggggtattcattaat
ggttacagcgccagcgatgcgcgtgtggcattcggcggggtgaagaaaagcggcttcggt
cgcgagctttcgcactttggtttacacgaattttgtaatgtgcagaccgtctggaagaac
cgcgtctaa

DBGET integrated database retrieval system