KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C30170Help
Entry
STMDT12_C30170    CDS       T01742                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Brite
KEGG Orthology (KO) [BR:sem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sem03016]
    STMDT12_C30170 (truC)
Enzymes [BR:sem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     STMDT12_C30170 (truC)
Transfer RNA biogenesis [BR:sem03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    STMDT12_C30170 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: BAJ37960
NITE: STMDT12_C30170
Position
complement(3138790..3139572)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDPWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLIIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHLT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagacccgtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacaggcccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcggtactg
gattatccgctggtggaagagcgcgataaaattgccgataaattcgcccgcgaagataaa
gcgccccagccggccgtaacgcagtatcgcgggctggcgacggtcgaaatggcggtgccg
accgggcgttatcccaccacgcgttatggcctggttgagctggaaccaaaaacgggacgc
aagcaccagcttcgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagtaaa
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcgtcttgaactgacgcaccccttcaccggacagccgttgataattcag
gccgggttggatgaaacctggatgcaggcgctgacgcagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatctgaca
taa

DBGET integrated database retrieval system