KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C42570Help
Entry
STMDT12_C42570    CDS       T01742                                 

Gene name
gldA2
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00561  Glycerolipid metabolism
sem00640  Propanoate metabolism
sem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STMDT12_C42570 (gldA2)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    STMDT12_C42570 (gldA2)
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     STMDT12_C42570 (gldA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: BAJ39200
NITE: STMDT12_C42570
Position
complement(4427792..4428895)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGANVIARLGDYLKPMANNWLVVGDKFVLGFAEETLRKSLTDAGLSVE
IAPFGGECSQNEIDRLRAVAEKSQCGAVLGIGGGKTLDTAKALAHFMNVPVAIAPTIAST
DAPCSALSVIYTDAGEFDRYLLLPHNPNMVIVDTQIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLIEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAIHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLDIKQDIPAKMRTVAEASCAEGETIHNMPGGATPDEVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcagtcaccaggtaagtatattcagggtgcaaacgtcatcgcgcgt
cttggcgattatttaaaaccaatggcgaacaactggctggttgtgggcgataaattcgtg
ctgggatttgccgaagagacgctgcgcaaaagcctgacggatgccggtttgtcagtagaa
atcgccccgtttggcggcgaatgttcgcaaaatgagatcgacaggctgcgcgccgtcgcc
gaaaaaagtcagtgtggcgccgtactgggtatcggcggcggtaaaacgctggataccgcc
aaagcgctggcgcactttatgaacgtcccggtcgctatcgcgccgaccatcgcctctacc
gacgcaccgtgcagcgcactctcggttatttataccgatgccggtgagtttgaccgttat
ctgctgctgccgcataacccgaatatggttattgtcgatacgcagatagtggcgggcgcg
ccggcgcgtctgctggcagccggtatcggcgatgcactggcgacctggtttgaagcgcgc
gcctgctcacgcagcggcgccaccacaatggcgggcggcaagtgtacacaggccgcgctg
gcgctggcggagctatgctataacacgctgatcgaagaaggcgaaaaagccatgttggcc
gccgaacagcacgtcgtcacgccagcgctggaacgcgtcatcgaagccaacacctacctg
agcggggtcggttttgaaagcggcggtctggccgcagcgcacgcgattcataacggttta
acggcgattccggatgcgcaccactattatcacggtgagaaggtcgctttcggtacgctg
acgcaactggtgctggaaaacgcgccggtcgaagaaatcgaaaccgttgcggcgctgtgc
cattccgttggcctgccgattacgctggcgcaactggatattaaacaggatattccggcc
aagatgcgcaccgtcgcggaagcctcctgcgcagaaggtgaaactattcataacatgcct
ggcggcgcaacgccggatgaagtgtacgccgcgctgctggtcgccgaccagtacggtcaa
cgcttcttgcaggaatgggaataa

DBGET integrated database retrieval system