KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C44110Help
Entry
STMDT12_C44110    CDS       T01742                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00010  Glycolysis / Gluconeogenesis
sem00620  Pyruvate metabolism
sem00640  Propanoate metabolism
sem00680  Methane metabolism
sem01100  Metabolic pathways
sem01110  Biosynthesis of secondary metabolites
sem01120  Microbial metabolism in diverse environments
sem01130  Biosynthesis of antibiotics
sem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMDT12_C44110
   00620 Pyruvate metabolism
    STMDT12_C44110
   00640 Propanoate metabolism
    STMDT12_C44110
  Energy metabolism
   00680 Methane metabolism
    STMDT12_C44110
Enzymes [BR:sem01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STMDT12_C44110
Lipid biosynthesis proteins [BR:sem01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STMDT12_C44110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAJ39354
NITE: STMDT12_C44110
Structure
PDB: 

Position
complement(4618803..4620761)
Genome map
AA seq 652 aa AA seqDB search
MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRF
ANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacacataaacacgccattcccgccaacattgcggatcgttgcctgataaat
ccagagcagtatgagactaaatataaacagtctattaacgaccccgatacgttttggggc
gaacagggaaaaattctcgattggatcacgccgtaccaaaaagtgaaaaacacctccttt
gcgccaggcaatgtgtcgattaaatggtacgaggacggcacgctgaatctggcggcgaac
tgtcttgaccgccatttgcaggaaaatggcgatcgcaccgccattatctgggaaggcgat
gacacgtcgcagagtaaacatatctcttatcgcgaactgcatcgcgatgtctgccgtttc
gcgaatacgctgctggatctgggcattaaaaaaggcgatgtggtagcgatttatatgccg
atggtgccggaagcggcggtggcaatgttggcctgcgcccgcatcggtgcggtgcattcg
gtgatcttcgggggcttctcgccggaagccgtcgccggacgcattatcgactccagctcg
cggctggtgatcaccgctgacgaaggtgtacgtgccggacgcagtatcccgctgaaaaag
aatgtcgatgacgcgctgaaaaacccgaatgtcactagcgttgagcatgtgatcgtcctg
aagcgcaccggcagcgacattgactggcaagaaggccgcgacctgtggtggcgcgatttg
attgaaaaagccagccctgagcaccagcctgaagcgatgaatgccgaagatccgctgttt
atcctttatacctccggctccaccggcaagccgaaaggcgtgctgcacaccaccggcggc
tatctggtctacgccgcgaccacctttaagtatgtctttgattatcaccctggcgatatt
tactggtgtaccgccgatgtgggttgggtgacggggcacagctatctgttgtatggcccg
ctggcctgcggcgcgaccaccttaatgtttgaaggcgtgccgaattggccaacgcccgct
cgcatgtgccaggtggtcgacaaacaccaggtcaacattctctataccgccccgacggcc
atccgcgcgctgatggcggaaggcgataaagccattgaaggcaccgaccgttcttcactg
cgcattctgggttccgtcggcgagccgatcaatcccgaagcgtgggaatggtactggaag
aagatcggcaaggaaaaatgtccggtcgtcgacacctggtggcagactgaaacaggcggt
tttatgatcacgccgctaccaggcgctatcgaactgaaagccggttccgccacccgtcct
ttctttggcgtacagcctgcgctggtggataacgaaggccatccgcaagaaggcgcgacg
gaaggcaatctggtcatcaccgattcctggccgggccaggcgcgcactctgttcggcgat
catgaacgttttgagcagacctatttctctacctttaagaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaggacggctattactggatcaccggtcgcgtggacgacgtgtta
aacgtctccggccaccgtctgggtacggcggaaatcgagtcagcgctggtggcgcatccg
aagatcgccgaagcggcggtggtgggtattccacacgctatcaaaggccaggcgatttac
gcttatgtgacgctcaaccacggcgaggagccgtcgccagaactgtacgcggaggtgcgc
aactgggtacgtaaagagattggcccactggcgacgccggacgtgctgcactggaccgac
tcactgccaaaaacccgttccggcaaaattatgcgccgcattttgcgcaaaatcgcggcg
ggcgataccagcaatctgggcgatacctcgactctcgccgatcctggcgtggtggagaaa
ctgctcgaagagaagcaggccatcgcgatgccgtcataa

DBGET integrated database retrieval system