KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_C46820Help
Entry
STMDT12_C46820    CDS       T01742                                 

Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
sem00230  Purine metabolism
sem00240  Pyrimidine metabolism
sem01100  Metabolic pathways
sem03030  DNA replication
sem03430  Mismatch repair
sem03440  Homologous recombination
Module
sem_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STMDT12_C46820
   00240 Pyrimidine metabolism
    STMDT12_C46820
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STMDT12_C46820
   03430 Mismatch repair
    STMDT12_C46820
   03440 Homologous recombination
    STMDT12_C46820
Enzymes [BR:sem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STMDT12_C46820
DNA replication proteins [BR:sem03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STMDT12_C46820
DNA repair and recombination proteins [BR:sem03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     STMDT12_C46820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: BAJ39625
NITE: STMDT12_C46820
Position
4909651..4910088
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacctgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system