KEGG   Saccharopolyspora erythraea: SACE_0398Help
Entry
SACE_0398         CDS       T00492                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase (partial match)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00790  Folate biosynthesis
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACE_0398 (folP)
Enzymes [BR:sen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SACE_0398 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind COMP
Motif
Other DBs
NCBI-ProteinID: CAL99746
Cambridge: SACE_0398
Kitasato: SACE_0398
UniProt: A4F6S2
Position
448140..448949
Genome map
AA seq 269 aa AA seqDB search
MGVLNVTPDSFSDGGRYLDRAAAVAHGVEMHRAGADIVDVGGESTRPGSERVDAETEIDR
VLPVVTELVAQGVPVSVDTTRARVAAATVRAGATVINDVSGGLADPDMAKVAAETGVPWV
LMHWRGHSKNMNSLAVYTDVVTEVRDELRRQVDVALEAGVSEDAIVLDPGLGFAKTGADD
WLLLQRLEVLVDLGFPVLVGASRKRFLGRLLADADGNPRPPAGRETATAVVSALAADRGA
WGVRVHDVVASLDAVAVTAAWNSGGELGG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgctgaacgtgacaccggactcgttctccgacggcggccgctacctcgaccgc
gcggccgcggtggcgcacggcgtggagatgcaccgcgcgggcgccgacatcgtcgacgtg
ggcggtgagtcgacccggccgggttcggagcgggtcgacgccgaaaccgagatcgaccgg
gtgctgccggtggtcaccgagctggtcgcccagggcgtgccggtcagcgtggacaccacg
cgggcgcgggtcgcggcggcgacggtgcgggccggggcgacggtgatcaacgacgtctcc
ggcggcctcgccgaccccgacatggccaaggtcgccgccgagaccggggtgccgtgggtg
ctgatgcactggcgcggccacagcaagaacatgaactcgctggccgtctacaccgacgtc
gtcaccgaggtgcgcgacgagctgaggcggcaggtcgatgtcgcactggaggccggggtc
tccgaagacgccatcgtgctggaccccggtctgggcttcgccaagaccggcgccgacgac
tggctcctgcttcagcggctggaggtgctggtcgacctcgggttcccggtgctggttgga
gcttcgcgcaagcggttcctcggcagactgctcgccgacgccgatggcaacccgaggccg
cccgcagggcgtgagaccgccaccgccgtggtctcggcgctggcagccgaccggggggct
tggggcgtgcgggtgcacgacgtcgtcgcctcgttggacgcggtcgcggtgaccgccgcg
tggaacagcggaggagagctcggtggctga

DBGET integrated database retrieval system