KEGG   Saccharopolyspora erythraea: SACE_1130Help
Entry
SACE_1130         CDS       T00492                                 

Definition
(GenBank) hypothetical protein
Organism
sen  Saccharopolyspora erythraea
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAM00461
Cambridge: SACE_1130
Kitasato: SACE_1130
UniProt: A4F8T6
Position
complement(1254782..1256032)
Genome map
AA seq 416 aa AA seqDB search
MTSTERQRGGDVLDPYLTTEPPTASGADDGYLPANWRVDTHPVTPIADETAIWGDKHTPD
LLGLASAVQTAQAAVRLQGDEALFEALSAGEIQSAQDYARRLRADQREHAYQARKALLDD
EAARREHEQGMTKRERDDEAATQVARYSYKRLTSPTGDLARLNTARLWVPMLALLPAVFA
VILGAANVGVELNRISAGTAWINWVVSPIFTVPVFAILVAQLAGFTITAPAPTVPFHRAP
FTWLKVGLLAVEVVLNVAPHYLGTGATGTAGALVFGLVPLGLAVSMVAAPKLRAHLTDRF
IAASKAAWGQPSTQDGKNPASTPSHLHGKNPHPAAGNDGDEASGEAENGFVPEPERKAAD
DHRAAFWAAVNSGEIDPAQESVNAIAKKLGTRWATADGFITAWEQATGQTRKQTKK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgaacgtcagcgcggcggcgacgtgctcgacccctacctgacgaccgag
ccgcccaccgcgagcggcgccgacgacgggtatctgccggccaactggcgggtggacacc
cacccggtcacgccgatcgccgacgagaccgcgatctggggtgacaagcacaccccggac
ttgctggggctggcaagcgcggtgcagaccgcccaggccgcggtccggttgcagggcgac
gaggcgctgttcgaggcgctgtccgcgggcgagatccagtccgcgcaggactacgcccgt
cggctgcgggccgaccagcgcgaacacgcctaccaggcccgcaaggcgctgctggacgac
gaggccgcgcgtcgcgagcacgagcagggcatgaccaagcgggagcgcgacgacgaggcc
gccacccaggtggcccgctactcctacaagcgcctgacctccccgaccggtgacctggcc
cggttgaacacggcgcggttgtgggtgccgatgctggcgctgctgccggcggtgttcgcg
gtgatcctcggggcggccaacgtgggcgtcgagctcaaccgcatctcggcgggcacagcg
tggatcaactgggtggtgagcccgatcttcacggtgccggtgttcgcgatcctcgtggcg
cagttggcggggttcaccatcaccgccccggccccgacggtccccttccatcgggcgccg
ttcacgtggctcaaggtcggcttgctcgcggtcgaggtggtgctcaacgtcgccccgcac
tacctcggcaccggcgccaccggcaccgcgggagcgctggtgttcggtctcgtccccctg
gggctggcggtgtcgatggtggccgcgccgaagctgcgcgcccacctcaccgaccggttc
atcgccgcctccaaggcggcatggggacagccgtccacccaggacgggaagaaccccgct
tccacgccttctcacctgcatgggaagaacccacaccccgccgccggaaacgacggcgac
gaagcctccggcgaagccgagaacgggttcgtcccggagcccgagcgcaaggccgccgac
gaccaccgcgcggcgttctgggccgcggtgaactccggcgagatcgatcccgcgcaggag
tcggtgaacgccatcgcgaagaagctcggcacccgctgggccaccgccgacgggtttatc
accgcctgggagcaggccaccgggcagacccgcaagcagaccaagaagtaa

DBGET integrated database retrieval system