KEGG   Saccharopolyspora erythraea: SACE_1742
Entry
SACE_1742         CDS       T00492                                 

Definition
(GenBank) protein of unknown function Mtu_121
Organism
sen  Saccharopolyspora erythraea
SSDB
Motif
Pfam: LCM
Other DBs
NCBI-ProteinID: CAM01060
Cambridge: SACE_1742
Kitasato: SACE_1742
UniProt: A4FAI5
Position
1919609..1920472
AA seq 287 aa
MSANEQWDIVSGVGITALAVAVARARESRRDDRLIDDPYAEPLIRAAQPPVPMSGDGGEA
GALWHEMTDYVSVRSRFFDEWFARACAAGTRQAVVLASGLDTRAFRLEWPEGFRVFEIDQ
PKVLEFKDGTLAAEGVRASCERHAVAVDLRDDWASALVKAGFDPALPTAWLAEGLLPYLP
PEAEANLLATVHDLSARGSRIAIESIALARSALLGADLDDTAREWGIDLKGLFSLEDRPD
PGDVLAQRGWRVHRDPVGDLAAGFRRPLSDRAQQLGAAGEMVTAQRD
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtctgcgaacgagcagtgggacatcgtctccggcgtcggcatcacggcgctggcggtc
gccgtcgcccgtgctcgggaaagccggcgcgacgaccggctgatcgacgacccgtacgcg
gaaccgctgatccgggcggcgcaaccgccggtgccgatgtcgggggacggcggcgaggcc
ggcgccctgtggcacgagatgaccgactacgtcagcgtccgttcccgcttcttcgacgaa
tggttcgcccgggcctgcgccgctggtacccgccaggcggtcgtcctggcctccgggctc
gacaccagggcgttccggctggagtggccggaaggcttccgggtcttcgagatcgaccag
cccaaggtcctggagttcaaggacggcaccctggccgccgagggcgtgcgcgcctcctgc
gaacgccacgcggtggcggtggacctgcgtgacgactgggcgtccgcgctggtcaaggcc
gggttcgaccccgcgctgcccacggcctggctcgccgaggggctgctgccctacctgccg
ccggaggcagaggcgaacctgctggccaccgtgcacgacctgtccgcccggggcagccgc
atcgcgatcgagagcatcgcgctggccaggtcggcgctgctgggcgccgacctcgacgac
accgcgcgggagtggggcatcgacctcaagggcctgttcagcctggaggaccgccccgac
cccggcgacgtgctggcccagcggggctggagggtgcaccgcgacccggtcggcgacctc
gccgccggcttccggcggcccctgagcgaccgcgcgcagcagttgggggcggcgggcgag
atggtcaccgcgcagcgcgactga

DBGET integrated database retrieval system