KEGG   Saccharopolyspora erythraea: SACE_1802Help
Entry
SACE_1802         CDS       T00492                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00520  Amino sugar and nucleotide sugar metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_1802 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    SACE_1802 (ppgK)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SACE_1802 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CAM01117
Cambridge: SACE_1802
Kitasato: SACE_1802
UniProt: A4FAP2
Position
complement(1985486..1986247)
Genome map
AA seq 253 aa AA seqDB search
MATARGFGVDIGGSGIKGSVVDIDAGVLAEERMRIPTPQPSTPAAVADAVAEIVEKFAWT
GPVGVTLPCVVKRGTAHTAANVDKSWIGTDAQALFAERLGKPREEVVVLNDADAAGLAEM
RSGAGAGHRGLVVLLTFGTGIGSAMFVDGKLIPNTEFGHIEVDGHDAETQAAASVKDNLE
LSYPEWAERVGRYLEGLEKFLWPDLIIAGGGVSRKAHKWLPLLECRTPIVAAELKNDAGI
VGAATAAAGGIEH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcccgcggtttcggcgtggacatcggcgggtccggcatcaagggctcggtt
gtggacatcgacgccggtgtgctggccgaggaacgcatgcgcatcccgaccccgcagccc
tcgaccccggccgccgtcgcggacgcggtggccgagatagtcgagaagttcgcgtggacg
ggtccggtcggcgtgacgctgccctgcgtcgtcaagcgcggaacggcccacaccgcagcg
aacgtcgacaagagctggatcggtacagacgcgcaggcgctgttcgccgagcggctcggc
aagccgcgcgaggaggtcgtcgtgctcaacgacgccgacgcggccggcctggccgagatg
cgctccggcgccggcgcgggccaccggggactcgtcgtgctgctgaccttcggcaccggc
atcggcagcgcgatgttcgtcgacggcaaactgatcccgaacaccgagttcggccacatc
gaggtcgacggccacgacgccgagacccaggccgccgcctcggtcaaggacaacctggag
ctgtcctacccggagtgggccgagcgcgtgggcaggtacctggaggggctggagaagttc
ctctggcccgacctgatcatcgcaggtggcggcgtcagccggaaggcgcacaagtggctg
ccgctgctggagtgccgcaccccgatcgtggccgccgagctgaagaacgacgcgggcatc
gtcggcgccgcgacggccgccgcgggcggcatcgagcactga

DBGET integrated database retrieval system