KEGG   Saccharopolyspora erythraea: SACE_2021
Entry
SACE_2021         CDS       T00492                                 

Gene name
rubC
Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SACE_2021 (rubC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sen03400]
    SACE_2021 (rubC)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     SACE_2021 (rubC)
DNA repair and recombination proteins [BR:sen03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SACE_2021 (rubC)
    RecFOR pathway proteins
     SACE_2021 (rubC)
SSDB
Motif
Pfam: RuvC KduI
Other DBs
NCBI-ProteinID: CAM01331
Cambridge: SACE_2021
Kitasato: SACE_2021
UniProt: A4FBA6
Position
2206709..2207308
AA seq 199 aa
MRVLGVDPGLTRCGIGVVDGGRGRTVTCVGVGVARTPADQELSARLLGVAEAVDEWLDTH
RPEVVAIERVFSQHNVRTVMGTAQVSGIVALAAARRGLPVAFHTPSEVKAAISGSGRADK
RQVTTMVTKILGLAEAPKPADAADALALAVCHLWRAPMAGRLAEAEAKAAALARNHKARL
KDARQAAAQRAARTGGVQR
NT seq 600 nt   +upstreamnt  +downstreamnt
gtgcgggtactcggtgtcgaccccggcctgacccgctgcgggatcggcgtggtcgacggc
gggcgcggccgcaccgtcacctgcgtcggtgtcggcgtggcgcggaccccggccgaccag
gagctgtccgcccggctgctgggcgtggccgaggccgtcgacgagtggctggacacccac
cggcccgaggtcgtcgcgatcgagcgggtcttcagccagcacaacgtccgcaccgtgatg
ggcaccgcgcaggtctccggcatcgtggcgctggccgccgcgcgccgcggcctgccggtt
gccttccacaccccgagcgaggtcaaggccgcgatcagcggatccggccgcgccgacaag
cgccaggtgaccaccatggtcaccaagatcctcgggctggccgaggccccgaagcccgcc
gacgccgccgacgcgctggcgctggccgtctgccacctctggcgggcgccgatggcgggc
cggctcgccgaggcagaggcgaaggccgcggcgctggcccgcaaccacaaggcgcgtctg
aaggacgcgcggcaggccgccgcccagcgggcggcgcggacaggaggagtccagcgatga

DBGET integrated database retrieval system