KEGG   Saccharopolyspora erythraea: SACE_2086Help
Entry
SACE_2086         CDS       T00492                                 

Gene name
padI
Definition
(GenBank) phenylacrylic acid decarboxylase-like protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00130  Ubiquinone and other terpenoid-quinone biosynthesis
sen00627  Aminobenzoate degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SACE_2086 (padI)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SACE_2086 (padI)
Enzymes [BR:sen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SACE_2086 (padI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CAM01393
Cambridge: SACE_2086
Kitasato: SACE_2086
UniProt: A4FBG8
Position
2273498..2274085
Genome map
AA seq 195 aa AA seqDB search
MIIGMTGATGAPLGVRLLEVLHDLPQVRTHLVMSRWARTTIELETPRTAREVAALADVVH
GSGDQAAAISSGSFRTDGMIIAPCSMKTLAGIRVGYADGLVGRAADVVLKERRKLVLVPR
ETPLSEIHLENMLALSRMGAVVVPPMPAFYNHPESVDDVVDHVVARVLDQFDLPAAAARR
WRGLAAARGTTDLKG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcgggatgaccggtgccaccggcgcgcccctcggagtgcggctgctggaggtg
ttgcacgacctgccgcaggtgcggacgcacctggtgatgagcaggtgggcgcggaccacg
atcgagctggagaccccgcgcaccgcgcgcgaggtcgccgcattggccgacgtcgtgcac
ggctccggcgaccaggcggccgccatctcgtcgggctcgttccgcaccgacggcatgatc
atcgccccgtgcagcatgaagacgctggccggcatccgcgtcggctacgccgacggcctc
gtgggacgcgccgccgacgtggtcctcaaggaacgccgcaagctcgtgctcgttccccgc
gagacaccgctgagcgagatccacctggagaacatgctcgcgctgtcgcggatgggcgcg
gtggtggtgccgccgatgcccgccttctacaaccacccggagtccgtcgacgacgtcgtc
gaccacgtcgtggcccgggtgctcgaccagttcgacctgcctgccgccgccgcgcgccgc
tggcgcgggctcgccgcggctcgtggcaccacagacctgaaggggtga

DBGET integrated database retrieval system