KEGG   Saccharopolyspora erythraea: SACE_2405Help
Entry
SACE_2405         CDS       T00492                                 

Definition
(GenBank) probable pyruvate dehydrogenase, E2 component,dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00020  Citrate cycle (TCA cycle)
sen00620  Pyruvate metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
Module
sen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2405
   00020 Citrate cycle (TCA cycle)
    SACE_2405
   00620 Pyruvate metabolism
    SACE_2405
Enzymes [BR:sen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SACE_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 BDV_P10
Motif
Other DBs
NCBI-ProteinID: CAM01703
Cambridge: SACE_2405
Kitasato: SACE_2405
UniProt: A4FCC8
Position
complement(2608566..2609870)
Genome map
AA seq 434 aa AA seqDB search
MAEFRMPSLGADMDQGTLVEWLVRPGDTINKGDIIAAVDTNKSTIDVECFETGVVDRLLV
DPGSIVPVGTPLAVITPRARGAPAAPPPPQPAPVAKAHRAVPTVSPPVRKLAARTGVDLT
TLHGTGRAGAITRADVEAAARTAAQPVPSPSPAPPTPSRRPVSPYARRLATELGVEPERL
TGSGPDGAVHARDVHRATQRPAEATPAPATAEGRPESMRRAIAALMAKSKREIPHYYLTS
TIDVGRAVEWLHEHNRHVPVTERLVPAALLLKAAALAARGVPELNGHWVDDRLVPSDSVH
LGVAVSLHGGGLLTPTLADADQLPLSELMHRLRDVVARARAARLRSSDTTTATITVTNLG
ELGVESVQGVIYPPQVGLVGFGAVMRRPWAVGELIGIRPVVTATLSGDHRASDGATGARF
LNTVDAVLQRPEEL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttccggatgccttccctcggcgccgacatggaccagggaaccctggtcgaa
tggctggtacgccccggggacaccatcaacaaaggcgacatcatcgcggcggtggacacc
aacaagtcgaccatcgacgtggagtgcttcgaaacgggagtcgtagaccgcctcctggtc
gaccccggcagcatcgtcccggtgggcactccgctcgcggtcatcacccctcgagcccga
ggagctcccgccgctcccccgcctccgcaacccgctcccgtggccaaggctcatcgcgcg
gtcccgaccgtctcgccccccgtgcgcaagctggccgcgcggacaggtgtcgacctcacg
acgctccacggcaccggacgcgcgggggcgatcacccgagccgacgtcgaggcagccgca
cgcacagccgcgcagccggtgccgagcccgtccccggcaccgcccacgccatcgcggcga
ccggtatcgccctacgcccggcggctggccaccgaactcggtgtcgaacccgagcggctg
acggggtccggcccggacggcgcggtccacgcgcgcgacgtccaccgggcaacgcagcgc
cccgccgaggccaccccggcgcctgccacggccgaaggacgcccggaatccatgcggcgc
gccatcgccgccctcatggccaaatccaagcgcgaaatcccgcactactacctgaccagc
accatcgacgtcggcagagccgtcgagtggctgcacgagcacaaccggcacgtccccgtc
accgaacgcctcgtgccggccgccctgctgctcaaggccgctgctctggcagcccgtggc
gtgcccgagctcaacggccactgggttgacgaccgcctggttcccagcgactcggtgcac
ctcggcgtcgcggtgtccctgcacggtggcggactgctcacccccaccctcgccgacgcc
gaccagctcccgctcagcgagctgatgcaccggctccgcgacgtggtcgcccgcgcccgc
gccgcgcggttgcggtcctcggacaccacgacggcgacgatcacggtgacgaacctcggc
gaactcggcgtcgagtcggtgcagggggtgatctacccgccgcaggtcggacttgtcggc
ttcggcgccgtcatgcgcaggccctgggcagtcggggagctgatcgggatccgccccgtg
gtcacggcaacgctgtccggcgaccaccgagcatccgacggcgccacgggcgctcgtttc
ttgaacaccgtcgacgcggtcctgcaacgaccggaggagttgtga

DBGET integrated database retrieval system