KEGG   Saccharopolyspora erythraea: SACE_2965Help
Entry
SACE_2965         CDS       T00492                                 

Gene name
dhlB
Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00361  Chlorocyclohexane and chlorobenzene degradation
sen00625  Chloroalkane and chloroalkene degradation
sen01100  Metabolic pathways
sen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_2965 (dhlB)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SACE_2965 (dhlB)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SACE_2965 (dhlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: CAM02243
Cambridge: SACE_2965
Kitasato: SACE_2965
UniProt: A4FDW8
Position
3248182..3248835
Genome map
AA seq 217 aa AA seqDB search
MVAFDVVETLMSLEPLRGRFAEVGLAPELVPRWFDRTLRDGMALTLAGDYAAFPEVGASA
LRTLAGGSLDEDAVAHVMRGFAALPAQPDAEPAMRVLSEAGIAVVCLSNGTAETTTGFLD
RTGLSRHVEQVISVADVRSWKPPRRVYEYALELTGCSAGEVFLVAVHAFDCHGAKRAGLG
AGWAGRLEGHYAEVFTPADVVGRDLVEVASRIAALPR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcgttcgacgtggtcgagacgctcatgtcgctggagccgctgcgcggccggttc
gccgaggtggggctcgcgccggagctggtgccgcgctggttcgaccggacgctgcgcgac
ggcatggcgctgacgctggcaggcgactacgcggcgttcccggaggtgggtgcgtcggcg
ttgcggacgctggccggcggctcgctcgacgaggacgccgtcgcgcacgtcatgcggggc
ttcgccgcgctgccggcccagcctgacgccgagcccgccatgcgggtgctctccgaagcc
gggatcgccgtggtgtgcctgagcaacggcaccgccgagacgacgaccgggttcctcgat
cgcaccggtctttcccgccacgtcgagcaggtcatcagcgtcgccgacgtccggagctgg
aaaccgccgcgccgcgtgtacgagtacgcactggagctgaccgggtgctccgccggcgag
gtcttcctggtcgccgtgcacgccttcgactgccacggtgccaagcgcgccggactcggc
gcggggtgggccggccggctggaagggcactacgccgaggtgttcaccccggccgacgtc
gtcggccgcgacctcgtcgaggtcgcgagccggatcgcagcgttgccccggtag

DBGET integrated database retrieval system