KEGG   Saccharopolyspora erythraea: SACE_3139Help
Entry
SACE_3139         CDS       T00492                                 

Gene name
agaB2
Definition
(GenBank) putative alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00052  Galactose metabolism
sen00561  Glycerolipid metabolism
sen00600  Sphingolipid metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACE_3139 (agaB2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SACE_3139 (agaB2)
   00600 Sphingolipid metabolism
    SACE_3139 (agaB2)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SACE_3139 (agaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: CAM02417
Cambridge: SACE_3139
Kitasato: SACE_3139
UniProt: A4FEE2
Position
3458545..3459687
Genome map
AA seq 380 aa AA seqDB search
MGWNSWNSFGCDIDERLIRDTADALVGSGMRDAGYQYVVVDDCWFDPQRDPQGNLRANPE
RFPSGIRALADYVHSRGLKFGIYQVPTEKTCAQRGGTYPGATGSLGHEEQDARTFAEWGV
DYLKYDWCSPEGTLEDQIAAFTKMRDALAATGRPIVYSINSNSYHPDKNGATHDWSPVAN
MWRTTEDIKPVWDSGNENEYPMGVVNIIDVNRGLAAQARPGHWNDPDMLEVGVYDVEGFK
GLTDTEARAHLSMWALMASPLIAGNNVTRMPDGIRDILTNREVVAVDQDPAGAQGVPVRD
HGDREVWVKNMADGSRVVALFNRGERPAGIRTTAREAGLPKASEYQVRDLWAHETSTTDG
EIRAEVPAHGVVLLRVSAQG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggctggaactcgtggaactccttcggatgcgacatcgacgagcggctgatccgcgac
accgccgacgccctggtcggctccggcatgcgagacgccggataccagtacgtcgtggtc
gacgactgctggttcgacccgcagcgcgatccgcagggcaacctgcgggccaaccccgag
cggttccccagcggcatcagggcgctggctgactacgtgcactcgcgtggcctgaagttc
ggcatctaccaggtcccgaccgagaagacgtgcgcgcagcgcggcggcacctacccgggc
gccaccggcagcctcgggcacgaggagcaggacgcgcggaccttcgccgagtggggcgtg
gactacctcaagtacgactggtgctcgccggagggcaccctcgaggaccagatcgcggcc
ttcaccaagatgcgcgacgcgctggccgcgaccggcaggccgatcgtctacagcatcaac
tccaacagctaccacccggacaagaacggcgcgacccacgactggtcgcccgtcgcgaac
atgtggcgcaccaccgaggacatcaagccggtgtgggactcgggcaacgagaacgagtac
ccgatgggcgtggtcaacatcatcgacgtcaaccgggggctcgccgcgcaggcacgtccc
ggtcactggaacgaccccgacatgctcgaggtcggcgtgtacgacgtcgaggggttcaag
ggcctgaccgacaccgaggcacgtgcgcacctgagcatgtgggcgctgatggcctcaccg
ctcatcgcgggcaacaacgtgacccggatgccggacggaatccgggacatcctgaccaac
cgggaggtcgtcgcggtcgaccaggacccggcgggtgcgcagggcgtcccggtccgcgac
cacggcgaccgcgaggtgtgggtcaagaacatggccgacggctcccgggtggtcgcgctg
ttcaaccggggcgagcgccccgcgggcatccggaccaccgcgcgcgaggccgggttgccc
aaggcgtccgagtaccaggtgcgcgatctctgggcgcacgagacctccacgaccgacggt
gagatccgggccgaggtcccggcgcacggcgtcgtcctgctgcgggtgtccgcgcagggc
tga

DBGET integrated database retrieval system