KEGG   Saccharopolyspora erythraea: SACE_3460Help
Entry
SACE_3460         CDS       T00492                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
sen  Saccharopolyspora erythraea
Brite
KEGG Orthology (KO) [BR:sen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SACE_3460 (pdxA)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     SACE_3460 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     SACE_3460 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA FCD
Motif
Other DBs
NCBI-ProteinID: CAM02734
Cambridge: SACE_3460
Kitasato: SACE_3460
UniProt: A4FFA9
Position
3816988..3818025
Genome map
AA seq 345 aa AA seqDB search
MSNGTARPILAVTLGDPVGIGPEITARVLAEPEATETARPLAVGDATALRRAVEVCGLDV
EVNTVSEVSQARFEPGAIDILDLGISPADLPWGQVDGTAGRSAVAAIETATRAALEEDVD
AIVTSPINKEAIWAAGSEHLGHTEMLGELTGSDRFNTMFWVQGLKIFFATRHMSLRRAVE
SITKDNIAHSIREAYTALEVFGTREPRLAVAALNPHGGENGKFGDEEITAIAPAVEEARA
AGLNVFGPIPADSVFHQGLQGRYDGVLSLYHDQGHIASKTVDFDGTVSVTVGLPILRTSV
DHGTAFDIAGTGQADPGTMRSAFRAAVELAPFAGRLREVYPPKAR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacggaaccgcccggccgatcctggccgtcaccctcggcgacccggtcggcatc
ggcccggagatcaccgcccgcgtgctggcagaacccgaggccaccgagaccgcccgcccg
ctggcggtaggcgacgccacggccctgcgccgcgccgtcgaggtctgcggcctggacgtc
gaggtcaacaccgtgtcggaggtgtcgcaggcccgcttcgaaccgggcgcgatcgacatc
ctcgacctggggatctcgcccgccgacctgccgtggggccaggtcgacggcaccgcgggc
cggtcggcggtggcggccatcgagaccgcgacccgggccgcgctggaggaggacgtcgac
gcgatcgtcacctcgccgatcaacaaggaggcgatctgggccgcgggctcggaacacctg
gggcacaccgagatgctcggtgagctcaccggctccgaccggttcaacacgatgttctgg
gtgcaggggctgaagatcttcttcgccacccggcacatgtcgctgcgccgggcggtggag
tcgatcaccaaggacaacatcgcgcactcgatccgcgaggcctacaccgccctcgaggtc
ttcggcacccgcgagccccggctcgcggtggccgcgctgaacccgcacggcggtgagaac
ggcaagttcggtgacgaggagatcaccgccatcgcccccgccgtcgaggaagcgcgggct
gccgggctcaacgtcttcgggccgatcccggccgactcggtcttccaccagggtctgcag
ggccgctacgacggcgtgctctcgctctaccacgaccagggccacatcgcctcgaagacg
gtcgacttcgacgggacggtgtcggtgaccgtcggcctgccgatcctgcgcacctcggtc
gaccacggcaccgccttcgacatcgcgggcaccggccaggccgaccccggcaccatgcgc
tcggcgttccgcgcggccgtcgagctggcgccgttcgcgggccgcctgcgcgaggtctac
ccgccgaaggcccgctga

DBGET integrated database retrieval system