KEGG   Saccharopolyspora erythraea: SACE_3954Help
Entry
SACE_3954         CDS       T00492                                 

Gene name
bkdC2
Definition
(GenBank) putative dihydrolipoamide acyltransferase component E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00020  Citrate cycle (TCA cycle)
sen00620  Pyruvate metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
Module
sen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_3954 (bkdC2)
   00020 Citrate cycle (TCA cycle)
    SACE_3954 (bkdC2)
   00620 Pyruvate metabolism
    SACE_3954 (bkdC2)
Enzymes [BR:sen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SACE_3954 (bkdC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CAM03225
Cambridge: SACE_3954
Kitasato: SACE_3954
UniProt: A4FGQ0
Position
4336514..4337878
Genome map
AA seq 454 aa AA seqDB search
MPEFALPDLGEGLTEAEIVNWLVAEGDQVRVDQPVVEVETAKAVVEVPCPYAGVVGRLHG
SAGETLTVGSPLLTVEEPGAGFTEPGVVVPDPAPAEEDSGNVLIGYGTSAAPARRNRRRR
RTASGAPVAAPVPAPAEPARGARSIAVISPLVRQLARENGIDLTRISGSGPQGVIRRCDV
DEAIAAQRAQAQTPTTTWETRAVHQDQPAAERETHAAPAGTPVAPEDSTRIPLRGLRRAV
ADKLTRSRREIPEATVWVDVDATGLLEARAALNARSPEQPVSVLALVSRFAVLGLRRFPE
LNSRVEQDEIVLLDRIHLGFAAQTDRGLVVPVVRDAQSMSTRELSDAMRTHTIAGREGSL
APSDLTGGTFTVNNYGVFGVDGSAAIINQPEAAILGVGRIIDRPWAVDGRLAVRKVCELT
LAFDHRVCDGGTAGGFLRFVADCVESPITALGEL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttcgcgctgccggacctcggcgagggcctgaccgaggccgagatcgtgaac
tggctggtcgccgagggcgaccaggtccgggtggaccagcccgtggtggaggtcgagacc
gccaaagccgtcgtggaggtgccgtgcccgtacgcgggcgtggtgggcaggctccacggt
tcggcgggcgagaccctgaccgtcggatcaccgctgctcaccgtcgaggaaccgggtgcc
ggcttcaccgagcccggtgtggtcgtgccggaccccgccccggcggaggaggacagcggc
aacgtcctcatcgggtacgggacctccgccgcaccggcgcggcgcaaccggcgccggcgg
cggaccgcgtccggtgctcccgtggccgcgcccgttccggcaccggccgagccggcgcgc
ggtgcccggtcgatcgcggtcatctcgcccctggtccgccagctcgcgagggagaacggc
atcgacctgacgcggatcagcggcagcggcccgcagggcgtgatccgccgctgcgacgtg
gacgaggcgatcgccgcccagcgggcgcaggcgcaaacccccaccacgacgtgggaaacg
cgcgctgtgcaccaggaccagcccgccgcggagagggaaacccatgccgcgccggctgga
actcctgtcgcgccggaggattccacccggatcccgctgcgcgggctgcgccgggcggtg
gccgacaagctcacgcggtcccgccgcgagatccccgaggcgacggtctgggtcgatgtc
gacgccaccgggctgctggaggcccgtgccgcgctcaacgcccgcagtcccgaacaaccg
gtcagcgtgctcgcgctggtctcccgcttcgccgtgctcggtctgcggaggttccccgag
ctgaactccagggtcgagcaggacgaaatcgtgctgctggaccggatccacctcggtttc
gccgcgcagaccgaccgcggcctggtggtgccggtggtccgcgacgcgcagtcgatgagc
acccgcgagctctccgacgcgatgcgcacgcacaccatcgccggccgcgagggctcgctg
gctccgtccgacctcaccggcggcacgttcacggtcaacaactacggcgtgttcggtgtg
gacggctcggcggcgatcatcaaccagccggaggcggcgatcctgggagtcggccgcatc
atcgaccgcccgtgggcggtggacggccggctcgccgtgcgcaaggtgtgcgagctgact
ctggcgttcgaccaccgcgtctgcgacggcggcaccgcaggcgggttcctgcggttcgtg
gccgactgcgtggagtccccgatcaccgcgctcggcgagttgtag

DBGET integrated database retrieval system