KEGG   Saccharopolyspora erythraea: SACE_4498Help
Entry
SACE_4498         CDS       T00492                                 

Gene name
folD
Definition
(GenBank) putative methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00670  One carbon pool by folate
sen01100  Metabolic pathways
sen01120  Microbial metabolism in diverse environments
sen01200  Carbon metabolism
Module
sen_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SACE_4498 (folD)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SACE_4498 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SACE_4498 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: CAM03767
Cambridge: SACE_4498
Kitasato: SACE_4498
UniProt: A4FI92
Position
5029514..5030395
Genome map
AA seq 293 aa AA seqDB search
MTTIPSSATSATKTLGGTELARGIRAEVTSAAAELTLLGVTPRLAVVVATDDESSAWYVR
SIARAAAKSGLLCDIVDLGADATTQSIRAELQRLSADPAVHGIILQTPLPAGANFEDLAA
SIAPDKDVDGANPLSLGRLAAGLPAYAPATAAAVLALLDHHEVPLAGRTGVVVGRSNVVG
KPAAQLLLQRDATVTVCHRYTQNLGHHTRTADVLVVAVGRPGLITAQHVAEHTVVIDVGT
NPTDDGGLVGDVDETSVSGRVAGLTPVPGGVGPVTTALLLQHTIQSASRSEPS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcccctcctcggccacctcggccacgaagaccctcggcggcaccgagctc
gcccgcggcatccgcgccgaggtcacctccgcggccgccgagctcaccctgctcggcgtc
accccgcgcctggccgtcgtggtggcgaccgacgacgagtccagcgcctggtacgtccgc
tcgatcgccagggcggcggcgaagtccggactcctgtgcgacatcgtggacctcggcgcg
gacgcgaccacgcagagcatccgcgccgaactgcagaggctcagcgccgacccggcggtg
cacgggatcatcctgcaaacgccgctgcccgccggcgcgaacttcgaggacctggccgcc
tcgatcgccccggacaaggacgtcgacggcgccaaccccctctcgctgggccgcctcgcc
gccgggctgcccgcctacgcgcccgccacggccgcggcggtcctggcgctgctcgaccac
cacgaggtgccgctggccgggcgcaccggcgtggtggtcgggcgctccaacgtcgtcggc
aaacccgcggcccaactgctgctgcagcgcgatgccacggtcacggtctgccaccgctac
acccagaacctcggccaccacacccgcaccgccgacgtcctggtggtggcggtcggccgc
ccggggctcatcaccgcccagcacgtcgccgagcacaccgtcgtcatcgacgtcggcacg
aaccccaccgatgacggcggactcgtcggcgatgtcgacgaaacctccgtcagcggccgg
gtcgccggcctgacgccggtgccgggcggagtcggccccgtcaccaccgcgctgctgctc
cagcacacgatccagagcgcgtcgcggtccgagccttcctag

DBGET integrated database retrieval system