KEGG   Saccharopolyspora erythraea: SACE_4729Help
Entry
SACE_4729         CDS       T00492                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00620  Pyruvate metabolism
sen00640  Propanoate metabolism
sen00680  Methane metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4729 (acsA)
   00620 Pyruvate metabolism
    SACE_4729 (acsA)
   00640 Propanoate metabolism
    SACE_4729 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SACE_4729 (acsA)
Enzymes [BR:sen01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SACE_4729 (acsA)
Lipid biosynthesis proteins [BR:sen01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SACE_4729 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAM03997
Cambridge: SACE_4729
Kitasato: SACE_4729
UniProt: A4FIX2
Position
5284512..5286479
Genome map
AA seq 655 aa AA seqDB search
MSIDAENARSAAEVAFPPSGEFAAQANATSELYAQADADREAFWADQARHLHWDTEWEQV
LDWSGAPFAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHWEGEPGDSRAITYAELAREVS
RTANALASLGVGAGDRVAIYLPMLPEAVYSMLACARLGALHSVVFGGFSSEALRTRINDA
QAKVVITADGQYRRGKAMPLKTNVDEAVAATPSVEHVLVVQRTKTDVEWNDGRDQWWHDV
VEGRPASHTPEFFDSEHPLFILYTSGTTGRPKGILHTSGGYLTQAAYTHRTVFDLKPETD
VYWCTADIGWVTGHTYIVYGPLANGATQVIYEGTPNTPHEGRHWDIVQKYGVTLYYTAPT
TIRTFMKWGAEIPARYDLSTLRVLGSVGEPINPEAWMWYREHIGGNRAPIVDTWWQTETG
AIMISPLPGVTATKPGSAQVPLPGIAAKVVDESGEQVGHGGGGLLVLDQPWPAMLRGIWG
DDDRYRETYWSKFADKGYYFAGDGAKYDDDGDIWLLGRVDDVMNVSGHRISTTEVESALV
SHPTVAEAAVVGASDPTTGQGIVAFVILRGGADDQASGEAAIKALRDHVAHEIGPIAKPR
QIMVVPELPKTRSGKIMRRLLRDVAENREIGDVSTLADSSVMNLISAGFATSSDD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgacgccgagaacgcgaggtccgcagccgaggtggcgttcccgccgtccggg
gagttcgccgcccaagccaatgcgacgtcggagctctacgcccaggccgacgccgaccgt
gaggcgttctgggccgaccaggcccgccacctgcactgggacaccgagtgggagcaggtg
ctggactggtccggcgccccgttcgccaagtggttcgtcggcggcaaactcaacgtcgcc
tacaactgcgtggaccgccacgtcgaggccggcaacggcgaccgggtggccatccactgg
gagggcgaaccgggcgattcccgcgccatcacctacgccgagctggcacgcgaggtctcc
cgcaccgccaacgcgctggcctcgctcggggtcggcgcgggcgaccgggtcgcgatctac
ctgccgatgctgcccgaggcggtctactcgatgctggcctgcgcccggctgggcgcgctg
cacagcgtggtgttcggcgggttctcctccgaagcgctgcgcacccgcatcaacgacgcc
caggccaaggtcgtcatcaccgccgacggccagtaccgccgcggcaaggccatgccgctc
aagaccaacgtcgacgaggccgtggccgccacccccagcgtcgaacacgtcctggtcgtc
caacgcaccaagaccgacgtggaatggaacgacggccgcgaccagtggtggcacgacgtc
gtcgagggccggcccgcatcccacaccccggagttcttcgactccgagcacccgctgttc
atcctctacacctccggcaccaccggacgccccaagggcatcctgcacacctccgggggc
tatctcacccaggccgcctacacccaccgcaccgtgttcgacctcaaacccgaaaccgac
gtgtactggtgcaccgccgacatcggctgggtcaccggccacacctacatcgtctacggg
ccgctggccaacggcgccacccaggtcatctacgaaggcacccccaacaccccgcacgaa
ggccgccactgggacatcgtccagaaatacggcgtcacgctctactacaccgcgccgacc
accatccgcaccttcatgaaatggggcgcggagatccccgcccgctacgacctgtccacc
ctgcgggtgctgggctcggtcggggaaccgatcaaccccgaggcctggatgtggtaccgc
gaacacatcggcggcaaccgcgcccccatcgtcgacacctggtggcagaccgaaaccggc
gcgatcatgatctcgccgctgcccggggtcaccgccaccaaacccggctccgcccaggtc
ccgctgcccggcatcgccgccaaggtcgtcgacgagtccggcgagcaggtcggccacggc
ggcggcggactgctggtgctggaccagccctggcccgcgatgctgcgcggcatctggggc
gacgacgaccgctaccgcgaaacctactggtcgaagttcgccgacaagggctactacttc
gccggcgacggcgccaaatacgacgacgacggcgacatctggctgctcggccgggtcgac
gacgtcatgaacgtctccggccaccgcatctccaccaccgaggtcgaatccgccctggtc
tcccaccccaccgtggccgaggccgccgtggtcggcgccagcgaccccaccaccggccag
ggcatcgtcgccttcgtcatcctgcgcggcggcgccgacgaccaggcctccggcgaagcc
gcgatcaaggccctacgcgaccacgtcgcccacgaaatcggccccatcgccaaaccccgc
cagatcatggtcgtgcccgaactgcccaaaacccgctccggcaagatcatgcgacggctc
ctgcgcgacgtcgccgaaaaccgcgaaatcggcgacgtctccaccctcgccgactcctcc
gtgatgaacctcatctccgccgggttcgccacctccagcgacgactga

DBGET integrated database retrieval system