KEGG   Saccharopolyspora erythraea: SACE_6060Help
Entry
SACE_6060         CDS       T00492                                 

Gene name
celA
Definition
(GenBank) endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00500  Starch and sucrose metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_6060 (celA)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SACE_6060 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: CAM05233
Cambridge: SACE_6060
Kitasato: SACE_6060
UniProt: A4FMF8
Position
complement(6796612..6797469)
Genome map
AA seq 285 aa AA seqDB search
MTDGFYADPASNPAEWVRANAGDPRATAIRTEIAEKPGARWFGDWNPDIAADVSGYVGAA
DAADELPSLVAYNIPGRDCGGHSGGGAGSQEAYRAWISDFAAAIGDRPSVVVIEPDALAQ
LDCMPEDERPVRLDLLSHAAAEFAEKAPNTWACMDGGNATWVEPPVLAERLRAIGVERIR
GFALNVSNYYTTEESVAKGDAIRQALVGSARFLVDSSRNGNGAAPGGEWCNPAGRGLGVP
SQVGGGADLLVWAKVPGDSDGDCGIGQGVPAGTFSPDPAMSLING
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggcttctacgccgaccctgcgtccaacccggcggaatgggtgcgcgccaac
gcgggagatccccgcgccacggccatccgcaccgagatcgccgagaagcccggcgcccgc
tggttcggcgactggaaccccgacatcgccgccgacgtgagcggctacgtcggcgccgcc
gacgcggcggacgagctgccgtcgctggtcgcctacaacatccccggacgtgactgcggc
ggccactccggcggcggcgcgggcagccaggaggcctaccgcgcgtggatctcggacttc
gcggccgcgatcggtgaccggccttcggtggtcgtcatcgagcccgacgcgctcgcgcag
ctcgactgcatgccggaggacgagcgtccggtccgcctggacctgctctcccacgccgcc
gcggagttcgccgagaaggcgccgaacacctgggcctgcatggacggaggcaacgcgacc
tgggtcgagccgccggtgctggccgagcggctccgggcgatcggtgtcgagcggatcagg
ggcttcgcgctcaacgtgtcgaactactacacgaccgaggagtcggtggccaagggcgac
gccatccggcaggcgctggtcggttcggcgcggttcctggtcgactccagccgcaacggc
aacggcgccgcgcccggcggtgaatggtgcaacccggcggggcgcgggctcggcgtgccg
agccaggtcggcgggggagcggacctgctggtgtgggccaaggtccccggcgactccgac
ggcgactgcggcatcggccagggcgttcccgcgggcaccttcagcccggatccggccatg
agcctgatcaacggctga

DBGET integrated database retrieval system