KEGG   Saccharopolyspora erythraea: SACE_6144
Entry
SACE_6144         CDS       T00492                                 

Gene name
leuC
Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00290  Valine, leucine and isoleucine biosynthesis
sen00660  C5-Branched dibasic acid metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01210  2-Oxocarboxylic acid metabolism
sen01230  Biosynthesis of amino acids
Module
sen_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SACE_6144 (leuC)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SACE_6144 (leuC)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     SACE_6144 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     SACE_6144 (leuC)
SSDB
Motif
Pfam: Aconitase AcnX
Other DBs
NCBI-ProteinID: CAM05317
Cambridge: SACE_6144
Kitasato: SACE_6144
UniProt: A4FMP2
Position
complement(6889069..6890472)
AA seq 467 aa
MGKTLAEKVWEAHIVRRGEGYEPDLLYIDLHLVHEVTSPQAFEGLRLAGRQVRRPDLTLA
TEDHNVPTTGIDLPIADPVSRTQVDTLRRNCEEFGIRLHPMGDAEQGIVHVVGPQLGLTQ
PGTTVVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTLPLRPFKTMAINIEGTLRPGVT
SKDVILAVIAKIGTGGGQGYVLEYRGSAVEKMSMEARMTMCNMSIEAGARAGMIAPDETT
FAYLQGRPHAPEGTEWDAAVEYWKTLRTDEDAEFDAEVTLDADELTPFVTWGTNPGQGLP
LGARIPDPAAIADESERFATEKALDYMGLEAGTPLREVAVDTVFLGSCTNGRIEDLRAAA
DVLKGRKVASEVRMLVVPGSMRVRKQAEAEGLNEVFTAAGAEWRSAGCSMCLGMNPDQLT
PGERSASTSNRNFEGRQGKGGRTHLVSPLVAAATAVRGTLSSPEDLD
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgggcaagacgctcgcggagaaggtctgggaagcgcacatcgtgcgccgcggcgagggc
tacgagcccgacctgctctacatcgacctccacctcgttcacgaggtcaccagcccgcag
gccttcgaggggctgcgcctggcggggcggcaggtgcgccgtcccgacctgacgctggcc
accgaggaccacaacgtgcccaccacgggcatcgacctgccgatcgcggacccggtttcg
cggacccaggtcgacaccctgcggcgcaactgcgaggagttcggcatccgcctgcacccg
atgggcgacgccgagcagggcatcgtgcacgtggtggggccccagctcggcctcacccag
cccggcacgaccgtcgtctgcggcgacagccacacctcgacccacggcgcgttcggcgcg
ctggccttcggcatcggcacctccgaggtcgagcacgtgctggcgacgcagacgcttccg
ttgcgtcccttcaagaccatggccatcaacatcgagggcacgctgcgcccgggggtcacg
agcaaggacgtgatcctggccgtcatcgccaagatcggcaccggcggcgggcagggctac
gtgctggagtaccggggcagcgccgtcgagaagatgtcgatggaagcccgcatgacgatg
tgcaacatgtcgatcgaggcgggtgcgcgggccggcatgatcgcgcccgacgagaccact
ttcgcctacctgcagggccgtccgcacgccccggagggcacggagtgggacgccgcggtc
gagtactggaagacgcttcgcaccgacgaggacgccgagttcgacgccgaggtgaccctc
gacgccgacgagctgaccccgttcgtcacgtggggcaccaaccccggtcagggcctgccg
ctgggcgctcggatcccggaccccgccgccatcgccgacgagagcgagcgcttcgcgacc
gagaaggcgttggactacatgggcctggaagcgggcactccgctgcgcgaggtggccgtg
gacacggtgttcctcggttcctgcaccaacggccggatcgaagatcttcgggccgcagcg
gacgttctgaagggccgcaaggtggcttcggaggtgcgcatgctggtcgtcccgggctcg
atgagggtccgcaagcaggccgaggccgaggggctcaacgaggttttcaccgccgccggg
gcggaatggcgttcggccggttgttcgatgtgcctgggcatgaaccccgaccagctcacc
cccggggagcgcagcgcgtcgacctccaaccgtaacttcgagggcaggcaaggaaagggc
ggccgcacccacctggtctcgccgctggtggccgccgcgaccgcggtgcgcggcaccctc
tcctcgcccgaagacctcgactga

DBGET integrated database retrieval system