KEGG   Saccharopolyspora erythraea: SACE_6187Help
Entry
SACE_6187         CDS       T00492                                 

Gene name
trmU
Definition
(GenBank) tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sen00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACE_6187 (trmU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sen03016]
    SACE_6187 (trmU)
Enzymes [BR:sen01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     SACE_6187 (trmU)
Transfer RNA biogenesis [BR:sen03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    SACE_6187 (trmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: CAM05360
Cambridge: SACE_6187
Kitasato: SACE_6187
UniProt: A4FMT5
Position
complement(6935823..6936869)
Genome map
AA seq 348 aa AA seqDB search
MAAARAVEAGHEVVGVHLALSAKPGTLRTGARGCCTIEDSHDARRAADILGIPFYVWDFA
ERFTEEVIETFVGEYAAGRTPNPCLTCNEKIKFEALLEKAMALGFDAVCTGHYARLTVED
GVPVLRRSRDEGKDQSYVLASLTAEQLGHSMFPLGDSLKSQVRQEAAERGLAVAKKPDSH
DICFIPDGDTKKFLESKLGQKPGQLVDAETGAVLGEHTGVHGFTVGQRKGLGIDAPAPDG
RPRYVLSLEPVSGTVKVGSADHLGVTEIDAKRPIWPSQRELDGPTECVVQVRAHGGTADA
VAEVADGGMSIRLRRPLRGVAPGQAVVLYRPEEEGDLVLGSALIAATR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccgcgcgggcggtggaggccggccacgaggtggtcggcgtgcacctggcgctg
tcggccaaacccggcacgctgcgcaccggtgcccgcggctgctgcacgatcgaggactcc
cacgacgcgcggcgggccgccgacatcctgggcatccccttctacgtctgggacttcgca
gagcggttcaccgaggaggtcatcgagaccttcgtcggcgagtacgccgcgggccgcacc
cccaacccgtgcctgacctgcaatgagaagatcaagttcgaggcgttgctggagaaggcg
atggcgctgggcttcgacgcggtctgcaccggccactacgcgcggctcaccgtcgaggac
ggcgtgccggtgctgcggcgcagccgggacgagggcaaggaccagtcctacgtgctggcc
tcgctgaccgccgagcagctggggcactcgatgttcccgctcggcgactcgctcaagtcg
caggtgcggcaggaggccgccgagcgcgggctcgcggtcgccaagaagcccgacagccac
gacatctgcttcatccccgacggcgacacgaagaagttcctcgagtcgaagctggggcag
aagcccgggcagctggtcgacgccgagaccggcgcggtgctcggtgagcacaccggcgtg
cacggcttcaccgtcgggcagcgcaaggggctcggcatcgacgcgcccgcacccgacggc
cggccgcgctacgtgctgtcgctggagccggtgtcgggcacggtcaaggtcggctccgcc
gaccacctcggcgtcaccgagatcgacgccaagcgcccgatctggccgtcgcagcgggag
ctcgacggcccgaccgagtgcgtcgtgcaggtccgcgcccacggcggcaccgcggacgcg
gtcgccgaggtcgccgacggcggcatgtcgatccggctccgccggccgctgcgcggcgtc
gcgccggggcaggccgtcgtgctgtaccggccggaggaggagggcgacctcgtcctcggc
agcgccctgatcgccgcgacgcgctag

DBGET integrated database retrieval system