KEGG   Saccharopolyspora erythraea: SACE_6467Help
Entry
SACE_6467         CDS       T00492                                 

Definition
(GenBank) nitroreductase family protein
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00680  Methane metabolism
sen01120  Microbial metabolism in diverse environments
Module
sen_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SACE_6467
Enzymes [BR:sen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     SACE_6467
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     SACE_6467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: CAM05636
Cambridge: SACE_6467
Kitasato: SACE_6467
UniProt: A4FNL1
Position
7253546..7254889
Genome map
AA seq 447 aa AA seqDB search
MKDHAARDGLRLFSVPGLPEFGPGDDLAASISAAAPWLSDGDVVVVTSKVVSKVEGRIVR
APSDPEERDELRRELVRSEAVQVLARRMRTLITENRLGIVQAASGVDASNVALDQIALLP
EDPDASARRLRAGLAERLGVHVGVVITDTMGRAWRVGQTDAAIGAAGLKVLHRYRGSTDP
QGNELAVTEVAVADEIAAAADLVKGKLGGVPVAVVRGLAPVDDGSTARDLVRPVEEDLFR
MGTAEALAQGRREAVLMRRSVRAFGPDPVDAEAVRRAVGAALTAPAPHHTRPVRFVWLRD
RPLRTKLLDAMRTAWLADLRRDGMSEEAAQRRVGRGDLLYAAPELVVPFLVREGAHDYPD
ERRGEAERSMFTVAAGAAVQGLLVALAAEDLGSCWVSSTMFCPDVVRSTLELPESWEPMG
TVAIGHPAEEVEGPRPPRDANDGLVEL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaccacgcggcacgggacggcctgcggctgttctcggtgcccggactgccggag
ttcggccccggcgacgacctcgccgcgtcgatctccgccgccgcgccgtggctcagcgac
ggcgacgtcgtggtggtcaccagcaaggtggtgtccaaggtcgagggccggatcgtgcgc
gccccgagcgatcccgaggagcgcgacgagctgcgccgcgagctggtccggtcggaggcc
gtgcaggtgctcgcgcgccgcatgcgcaccctgatcaccgagaaccggctcggcatcgtg
caggccgcctccggcgtggacgcctccaacgtcgcgctcgaccagatcgcgctgctgccg
gaggaccccgacgcctcggcccgcaggctgcgcgccgggctcgccgaacgtctcggcgtg
cacgtcggcgtcgtcatcaccgacaccatgggccgcgcctggcgcgtcgggcagaccgac
gccgcgatcggcgcggccggcctgaaggtgctgcaccgctaccggggcagcaccgacccg
cagggcaacgagctggctgtgaccgaggtcgcggtggccgacgagatcgcggccgcggcc
gacctggtcaagggcaagctcggcggggtgccggtcgcggtggtgcgcggactggccccg
gtagacgacggttccaccgcgcgcgacctggtccgcccggtcgaggaggacctgttccgg
atgggcaccgccgaggcgctggcgcagggccgccgggaggcagtgctgatgcgccggtcc
gtgcgggccttcggcccggaccccgtcgacgccgaggccgtccgccgggccgtcggcgcg
gcgctgaccgctcccgccccgcaccacacccggccggtgcggttcgtctggctgcgcgac
cgtccacttcggacgaagctgctcgacgcgatgcgcaccgcgtggctggccgacctgcgc
cgcgacggcatgtcggaggaggcggcgcagcgccgggtcggtcgcggcgacctgctctac
gccgcgccggagctggtggtgcccttcctggtgcgcgaaggcgcccacgactaccccgac
gagcgtcgcggcgaggccgagcggtcgatgttcacggtggctgcgggcgcggctgtgcag
ggtctgctggtcgcgctggctgccgaggacctcggctcgtgctgggtgtcctcgacgatg
ttctgcccggacgtggtgcgctcgacgctggagctgccggagagctgggaaccgatgggc
accgtggcgatcggccaccccgcggaggaagtcgaaggcccccgcccgccccgcgacgcg
aatgacgggctggtggagctgtga

DBGET integrated database retrieval system