KEGG   Saccharopolyspora erythraea: SACE_6693Help
Entry
SACE_6693         CDS       T00492                                 

Definition
(GenBank) hypothetical protein
Organism
sen  Saccharopolyspora erythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TMEM234 TPT RseC_MucC UAA
Motif
Other DBs
NCBI-ProteinID: CAM05859
Cambridge: SACE_6693
Kitasato: SACE_6693
UniProt: A4FP84
Position
7494815..7495786
Genome map
AA seq 323 aa AA seqDB search
MNNPASYYRLAALALLWGSSFLLIKVALEALSPTQVALTRIVLGALVLVALCAVRGIRLR
GSAALWRRIATAGLFASALPWVLFGVGEQTVASGLTGVINATTPLWTALFGMLLARETPP
KSRLAGLGVGFAGVVLIFAPWQGGDLLTPGVLACLGAAASYGVGYVYIGRKLTGESLREH
GLSPLALAAMQMIAAAGFAAIALPIDGLRPVHPEPLALLSLAVLGVLGTGIAFAMNYRLI
ADEGATTASSVAYLMPIVSVLLGWLVLDEQLGARVLTGMALVLAGVLLLRRSNRPTTEKP
RIVRGLLRGSKLYAELATNHPGK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatccagccagctactaccgcctcgcggcgctcgcgctgctgtggggctccagc
ttcctgctcatcaaggtcgcgctggaggcgctgtcgccgacccaggtcgcgctgacgcgc
atcgtgctcggggcactggtgctggtcgcgctgtgcgcggtgcgcggcatccggctgcgc
ggcagcgcggcgctgtggcggcggatcgccactgccgggctgttcgccagcgcgctgccg
tgggtgcttttcggcgtcggcgagcagaccgtcgcctcgggcctcaccggcgtcatcaac
gcgacgacgccgctgtggaccgccttgttcggcatgctcctcgcgcgtgagacgccgccg
aagtcccggctcgccggactcggggtcggcttcgcgggcgtcgtgctgatcttcgcgccc
tggcagggcggcgacctgctgacaccgggcgtgctggcctgcctcggcgcagcggcgtcc
tacggcgtcgggtacgtctacatcggacggaagctcaccggggaaagcctgcgggagcac
ggactttccccgctggcgctggcggcgatgcagatgatcgccgcagcgggtttcgcggcg
atcgcgctcccgatcgacgggttgcggcctgtgcacccggagccgctggccctgctgtcg
ctcgcggtgctgggcgtgctcggaaccggcatcgcgttcgcgatgaactaccggctgatc
gccgacgagggcgccacgacggcttcgagcgtcgcgtacctgatgcccatcgtctcggtg
ctgctcggctggctggtgctcgacgaacagctcggtgcgcgggtgctgacgggcatggcc
ctggtcctggcgggcgtgctgctgctccggcgctcgaaccggccgacgacggagaagccg
cggatcgtgcggggcctcctgcggggctcgaagctctacgccgagctggcgacgaaccac
ccggggaagtga

DBGET integrated database retrieval system