KEGG   Saccharopolyspora erythraea: SACE_7184Help
Entry
SACE_7184         CDS       T00492                                 

Gene name
nagA
Definition
(GenBank) putative N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00520  Amino sugar and nucleotide sugar metabolism
sen01100  Metabolic pathways
sen01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SACE_7184 (nagA)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SACE_7184 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CAM06342
Cambridge: SACE_7184
Kitasato: SACE_7184
UniProt: A4FQL7
Position
7987835..7988971
Genome map
AA seq 378 aa AA seqDB search
MNESPSLTLAGGRVVTPDGVLDDGWVRVSGSTIEAVGTGAVAGAVDLGGRWLVPGFVDIH
CHGGGGGSFTGTEVDQALAAIDTHRAHGTTTMLASLVSAPPADLCKQISALGELVTDGRI
AGIHLEGPFLSAARCGAHDPAILRPPETHAVQQLLDAGQGTIRMITLAPELDNSVNAVRR
LVDHGVIAAVGHTDAVLEQVVPAVDAGATVATHLFNGMRPLHHREPGPIGALLDDERVTV
ELICDLVHLHPGVVKLAAGHAGAGRTVLITDAISATAAGDGVYELGKLPVTVTDGEPRLA
DGSLAGSTLTMDVAFRNLVACGLPVTDAVAAASARPAALLGLSDRIGAIRPGLAADLVVL
DDDLGLHRVMKDGRWVDA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagtccccctcgctgacactcgcaggcgggcgcgtcgtcaccccggacggggtc
ctcgacgacggctgggtgcgcgtgtcgggttcgacgatcgaagccgtcggcaccggtgcg
gtcgccggagcggtggacctgggcgggcggtggctggtgcccggcttcgtcgacatccac
tgccacggcggcgggggtggctccttcaccggcaccgaggtcgaccaggcgctggccgcc
atcgacacccaccgcgcgcacggcacgacgacgatgctggccagcctggtgtcggcgccg
ccggccgacctgtgcaagcagatcagcgcgctcggcgagctggtcaccgacggcaggatc
gcgggcatccacctggagggcccgttcctttcggccgcccgctgcggcgcgcacgacccg
gcgatcctgcgcccgccggagacccacgccgtccagcaactgctcgacgccggccagggg
acgatccggatgatcacgctggcgccggagctggacaactcggtgaacgcggtccgccgg
ctcgtcgaccacggcgtgatcgcggccgtcgggcacaccgacgcggtgctggagcaggtc
gtgcccgccgtggacgccggtgcgacggtggccacccacctgttcaacgggatgcggccg
ctgcaccaccgcgagccgggtccgatcggcgccctgctcgacgacgagcgggtgaccgtg
gagctcatctgcgacctggtgcacctgcaccccggcgtggtcaagctcgccgccgggcac
gccggggcgggccggacggtgctgatcaccgacgccatcagcgcgacggcggccggcgac
ggcgtctacgagctgggcaagctgccggtcacggtcaccgacggcgagccccggctggcc
gacggctcgctggcgggcagcaccctgaccatggacgtggcgttccgcaacctggtggcg
tgcgggctgccggtgaccgacgcggtcgccgccgcgtccgcccgcccggccgcgctgctg
ggcttgtccgaccgtatcggcgccatccggccgggcctggccgccgacctggtcgtgctc
gacgacgacctcggcctgcaccgcgtgatgaaggacgggcgctgggtcgacgcctga

DBGET integrated database retrieval system